[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : ompX
DDBJ      :ompX         outer membrane protein X
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  6/175   --->[See Alignment]
f.4.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->171 1qj8A PDBj 1e-75 90.0 %
:RPS:PDB   35->171 1bxwA PDBj 1e-05 16.2 %
:RPS:SCOP  32->171 1qj8A  f.4.1.1 * 6e-19 90.0 %
:HMM:SCOP  24->171 1qj8A_ f.4.1.1 * 8e-34 32.4 %
:RPS:PFM   32->171 PF06316 * Ail_Lom 2e-23 52.9 %
:HMM:PFM   2->171 PF06316 * Ail_Lom 8.7e-24 38.1 168/199  
:BLT:SWISS 1->171 OMPX_SHIFL 1e-76 86.5 %
:PROS 46->54|PS00694|ENT_VIR_OMP_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66042.1 GT:GENE ompX GT:PRODUCT outer membrane protein X GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 948969..949484 GB:FROM 948969 GB:TO 949484 GB:DIRECTION + GB:GENE ompX GB:PRODUCT outer membrane protein X GB:NOTE identified by match to protein family HMM PF06316 GB:PROTEIN_ID ACF66042.1 GB:DB_XREF GI:194405823 GB:GENE:GENE ompX LENGTH 171 SQ:AASEQ MKKIACLSALAAVLAFSAGTAVAATSTVTGGYAQSDAQGVANKMSGFNLKYRYEQDDNPLGVIGSFTYTEKDRTNGAGDYNKGQYYGITAGPAYRLNDWASIYGVVGVGYGKFQTTDYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 1->171|OMPX_SHIFL|1e-76|86.5|171/171| PROS 46->54|PS00694|ENT_VIR_OMP_1|PDOC00582| TM:NTM 1 TM:REGION 6->28| SEG 7->31|lsalaavlafsagtavaatstvtgg| BL:PDB:NREP 1 BL:PDB:REP 32->171|1qj8A|1e-75|90.0|140/148| RP:PDB:NREP 1 RP:PDB:REP 35->171|1bxwA|1e-05|16.2|136/172| RP:PFM:NREP 1 RP:PFM:REP 32->171|PF06316|2e-23|52.9|138/184|Ail_Lom| HM:PFM:NREP 1 HM:PFM:REP 2->171|PF06316|8.7e-24|38.1|168/199|Ail_Lom| GO:PFM:NREP 1 GO:PFM GO:0009279|"GO:cell outer membrane"|PF06316|IPR000758| RP:SCP:NREP 1 RP:SCP:REP 32->171|1qj8A|6e-19|90.0|140/148|f.4.1.1| HM:SCP:REP 24->171|1qj8A_|8e-34|32.4|148/0|f.4.1.1|1/1|OMPA-like| OP:NHOMO 269 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11112211CB3131412-F215263355E43222222211221323243433343336334143132322-244443444444--1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------1--1----1--------111------------------ STR:NPRED 140 STR:RPRED 81.9 SQ:SECSTR ###############################EEEcccccccccEEEEEEEEEEEEETTcEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEccTTTccEEEEEEEEEEEEEEEEEccccEEEcccccccccccccccEEEEEEEEEE DISOP:02AL 1-1,117-126| PSIPRED cHHHHHHHHHHHHHHHEEEEEccccEEEEEEEEEEcccccccccccEEEEEEEEEccccEEEEEEEEEEccccccccccEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEcccccccccccccEEEEEEEEEEEcccccEEEEEEEEEcccccEEEccEEEEEEEEc //