[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : osmE
DDBJ      :osmE         osmotically-inducible lipoprotein E
Swiss-Prot:OSME_SHIFL   RecName: Full=Osmotically-inducible lipoprotein E;AltName: Full=Activator of ntr-like gene protein;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  79/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   36->97 PF04355 * SmpA_OmlA 5e-04 37.3 %
:HMM:PFM   33->96 PF04355 * SmpA_OmlA 2.3e-15 29.5 61/71  
:HMM:PFM   1->21 PF08085 * Entericidin 0.00061 47.6 21/42  
:BLT:SWISS 1->112 OSME_SHIFL 3e-60 96.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70297.1 GT:GENE osmE GT:PRODUCT osmotically-inducible lipoprotein E GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1396210..1396551 GB:FROM 1396210 GB:TO 1396551 GB:DIRECTION + GB:GENE osmE GB:PRODUCT osmotically-inducible lipoprotein E GB:NOTE identified by match to protein family HMM PF04355 GB:PROTEIN_ID ACF70297.1 GB:DB_XREF GI:194410078 GB:GENE:GENE osmE LENGTH 113 SQ:AASEQ MNKNVAGILSAAAVMTMLAGCTAYDRTKDQFVEPVVKDVKKGMSRAQVAQIAGKPSSEVSMIHARGTCQTYILGQRDGKAETYFVALDDTGHVINSGYQTCAEYDTDPQAPKQ GT:EXON 1|1-113:0| SW:ID OSME_SHIFL SW:DE RecName: Full=Osmotically-inducible lipoprotein E;AltName: Full=Activator of ntr-like gene protein;Flags: Precursor; SW:GN Name=osmE; OrderedLocusNames=SF1487, S1604; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->112|OSME_SHIFL|3e-60|96.4|112/112| GO:SWS:NREP 2 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| RP:PFM:NREP 1 RP:PFM:REP 36->97|PF04355|5e-04|37.3|59/71|SmpA_OmlA| HM:PFM:NREP 2 HM:PFM:REP 33->96|PF04355|2.3e-15|29.5|61/71|SmpA_OmlA| HM:PFM:REP 1->21|PF08085|0.00061|47.6|21/42|Entericidin| GO:PFM:NREP 1 GO:PFM GO:0019867|"GO:outer membrane"|PF04355|IPR007450| OP:NHOMO 80 OP:NHOMOORG 79 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111111111111-111111111111111111111111---1111111111111111111111111----------------------------------------------------------11111---112111111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,103-114| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccHHHHccccHHHHHHHccHHHHHHHccccccEEEEEcccccEEEEEEEccccccccEEEEEcccccEEccHHHHHHHHHccHHHHcc //