[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : pagP
DDBJ      :pagP         antimicrobial peptide resistance and lipid A acylation protein PagP
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  90/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.4.1
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->186 1mm4A PDBj 2e-90 86.0 %
:RPS:SCOP  33->186 1thqA  f.4.1.2 * 1e-31 85.4 %
:HMM:SCOP  25->186 1mm4A_ f.4.1.2 * 8.4e-81 63.6 %
:RPS:PFM   37->183 PF07017 * PagP 3e-66 84.9 %
:HMM:PFM   37->183 PF07017 * PagP 5.7e-79 66.4 146/147  
:BLT:SWISS 1->186 CRCA_ECOLI 3e-92 75.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69619.1 GT:GENE pagP GT:PRODUCT antimicrobial peptide resistance and lipid A acylation protein PagP GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 740596..741156 GB:FROM 740596 GB:TO 741156 GB:DIRECTION + GB:GENE pagP GB:PRODUCT antimicrobial peptide resistance and lipid A acylation protein PagP GB:NOTE identified by match to protein family HMM PF07017 GB:PROTEIN_ID ACF69619.1 GB:DB_XREF GI:194409400 GB:GENE:GENE pagP LENGTH 186 SQ:AASEQ MIIRKYFLIIALLVMPWLAIPSVSAADKGWFNTFTDNVAETWRQPEHYDLYVPAITWHARFAYDKEKTDRYNERPWGVGFGQSRWDDKGNWHGLYMMAFKDSFNKWEPIGGYGWEKTWRPLEDDNFRLGLGFTAGVTARDNWNYIPIPVLLPLASIGYGPATFQMTYIPGSYNNGNVYFAWMRFQF GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 1->186|CRCA_ECOLI|3e-92|75.8|186/100| TM:NTM 2 TM:REGION 6->28| TM:REGION 146->168| BL:PDB:NREP 1 BL:PDB:REP 30->186|1mm4A|2e-90|86.0|157/170| RP:PFM:NREP 1 RP:PFM:REP 37->183|PF07017|3e-66|84.9|146/147|PagP| HM:PFM:NREP 1 HM:PFM:REP 37->183|PF07017|5.7e-79|66.4|146/147|PagP| RP:SCP:NREP 1 RP:SCP:REP 33->186|1thqA|1e-31|85.4|144/147|f.4.1.2| HM:SCP:REP 25->186|1mm4A_|8.4e-81|63.6|162/170|f.4.1.2|1/1|OMPA-like| OP:NHOMO 95 OP:NHOMOORG 90 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----------------------------------------------1-21--1-------------------------------------------------------------------------------------------------------------------11112211111111111-1121-1111111111111112111111111111111111111-11-111111-111111111111---------1111-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 84.4 SQ:SECSTR #############################HHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccEEEEEEEEETTTEEEEEEEEEEEcccccEEEEEEEEEEEEEcccccccEEEEEEEEEEEEcccccccccEEEEEEEEEEEETTEEEEEEccccccccccccccEEEEEE DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEHHcHHHHHHHcccccccccccEEEcccccEEEEEEEEHHHHHccccccccccHHHcccccccccEEEEEEEEEEEEEEEccccccccHHHHHHcccccEEEEEEEEcccccccccEEEEEEEEcc //