[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : pal
DDBJ      :pal          peptidoglycan-associated lipoprotein
Swiss-Prot:PAL_SHIFL    RecName: Full=Peptidoglycan-associated lipoprotein;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  533/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.79.7
:174 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   69->174 1oapA PDBj 1e-57 98.1 %
:RPS:PDB   46->174 2aizP PDBj 5e-28 59.4 %
:RPS:SCOP  69->174 1oapA  d.79.7.1 * 4e-31 98.1 %
:HMM:SCOP  67->174 1oapA_ d.79.7.1 * 1.2e-30 38.0 %
:RPS:PFM   74->171 PF00691 * OmpA 9e-14 41.5 %
:HMM:PFM   73->168 PF00691 * OmpA 1.2e-21 31.6 95/97  
:HMM:PFM   14->80 PF04360 * Serglycin 0.00011 31.7 63/150  
:BLT:SWISS 1->174 PAL_SHIFL 8e-84 97.7 %
:PROS 106->150|PS01068|OMPA_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69132.1 GT:GENE pal GT:PRODUCT peptidoglycan-associated lipoprotein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 865530..866054 GB:FROM 865530 GB:TO 866054 GB:DIRECTION + GB:GENE pal GB:PRODUCT peptidoglycan-associated lipoprotein GB:NOTE identified by match to protein family HMM PF00691; match to protein family HMM TIGR02802 GB:PROTEIN_ID ACF69132.1 GB:DB_XREF GI:194408913 GB:GENE:GENE pal LENGTH 174 SQ:AASEQ MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGGMLNGAGTGMDANGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAAMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYAKNRRAVLVY GT:EXON 1|1-174:0| SW:ID PAL_SHIFL SW:DE RecName: Full=Peptidoglycan-associated lipoprotein;Flags: Precursor; SW:GN Name=pal; OrderedLocusNames=SF0556, S0569; SW:KW Cell membrane; Cell outer membrane; Complete proteome; Lipoprotein;Membrane; Palmitate; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->174|PAL_SHIFL|8e-84|97.7|172/173| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| PROS 106->150|PS01068|OMPA_1|PDOC00819| TM:NTM 1 TM:REGION 5->26| SEG 58->68|qarlqmqqlqq| BL:PDB:NREP 1 BL:PDB:REP 69->174|1oapA|1e-57|98.1|106/108| RP:PDB:NREP 1 RP:PDB:REP 46->174|2aizP|5e-28|59.4|128/134| RP:PFM:NREP 1 RP:PFM:REP 74->171|PF00691|9e-14|41.5|94/97|OmpA| HM:PFM:NREP 2 HM:PFM:REP 73->168|PF00691|1.2e-21|31.6|95/97|OmpA| HM:PFM:REP 14->80|PF04360|0.00011|31.7|63/150|Serglycin| GO:PFM:NREP 1 GO:PFM GO:0009279|"GO:cell outer membrane"|PF00691|IPR006665| RP:SCP:NREP 1 RP:SCP:REP 69->174|1oapA|4e-31|98.1|106/108|d.79.7.1| HM:SCP:REP 67->174|1oapA_|1.2e-30|38.0|108/108|d.79.7.1|1/1|OmpA-like| OP:NHOMO 1044 OP:NHOMOORG 538 OP:PATTERN -------------------------------------------------------------------- 323--------------------------------------------------------------------------------1-111111--2111--1534436G516111111111111111213331223-2-----------------11-----------1--1--------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------6221-344411111211211211111122222222222-112111121211211123222322122223111111213111111111111144211111111--11111111111111111111343322222252232321111223311111341232322422232433322332111522211-------212325155244421222211836254342115269513222222222211111111111311111111241312233333422444433124231-44312-1----11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111131111111112353311111-12221111123333324354433335344634344444111111111252213333376322232434423322221111112233----------------------------------------------11- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------2--------1-----1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 74.1 SQ:SECSTR #############################################cccccccccccTTccHHHHTTTccEEEEccTTcccccHHHHHHHHHHHHHHHHcTTccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHTTccGGGEEEEEcTTTccccccccHHHHHHHcEEEEEc DISOP:02AL 1-3,22-39,45-63| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHEEEEcccEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEccccccccccccHHHHHccccEEEEc //