[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : panC
DDBJ      :panC         pantoate--beta-alanine ligase
Swiss-Prot:PANC_SALHS   RecName: Full=Pantothenate synthetase;         Short=PS;         EC=6.3.2.1;AltName: Full=Pantoate--beta-alanine ligase;AltName: Full=Pantoate-activating enzyme;

Homologs  Archaea  0/68 : Bacteria  701/915 : Eukaryota  122/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->282 1ihoA PDBj e-127 80.5 %
:RPS:PDB   1->283 2a88A PDBj 2e-79 41.4 %
:RPS:SCOP  1->282 1ihoA  c.26.1.4 * 3e-54 84.4 %
:HMM:SCOP  1->282 1ihoA_ c.26.1.4 * 1.6e-105 52.1 %
:RPS:PFM   2->277 PF02569 * Pantoate_ligase 5e-76 53.8 %
:HMM:PFM   1->279 PF02569 * Pantoate_ligase 6.2e-118 54.7 278/280  
:BLT:SWISS 1->284 PANC_SALHS e-152 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67832.1 GT:GENE panC GT:PRODUCT pantoate--beta-alanine ligase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(219189..220043) GB:FROM 219189 GB:TO 220043 GB:DIRECTION - GB:GENE panC GB:PRODUCT pantoate--beta-alanine ligase GB:NOTE identified by match to protein family HMM PF02569; match to protein family HMM TIGR00018; match to protein family HMM TIGR00125 GB:PROTEIN_ID ACF67832.1 GB:DB_XREF GI:194407613 GB:GENE:GENE panC LENGTH 284 SQ:AASEQ MLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEAKARADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPHGLEGQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMVADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNVMNSIAEKLIAGNRELQEIIAIAEQELNEKGFRADDIQIRDADTLQELTETSKRAVILAAAWLGQARLIDNQSVTLAQ GT:EXON 1|1-284:0| SW:ID PANC_SALHS SW:DE RecName: Full=Pantothenate synthetase; Short=PS; EC=6.3.2.1;AltName: Full=Pantoate--beta-alanine ligase;AltName: Full=Pantoate-activating enzyme; SW:GN Name=panC; OrderedLocusNames=SeHA_C0213; SW:KW ATP-binding; Complete proteome; Cytoplasm; Ligase; Nucleotide-binding;Pantothenate biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->284|PANC_SALHS|e-152|100.0|284/284| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0015940|"GO:pantothenate biosynthetic process"|Pantothenate biosynthesis| SEG 221->233|elqeiiaiaeqel| BL:PDB:NREP 1 BL:PDB:REP 1->282|1ihoA|e-127|80.5|282/282| RP:PDB:NREP 1 RP:PDB:REP 1->283|2a88A|2e-79|41.4|266/276| RP:PFM:NREP 1 RP:PFM:REP 2->277|PF02569|5e-76|53.8|275/279|Pantoate_ligase| HM:PFM:NREP 1 HM:PFM:REP 1->279|PF02569|6.2e-118|54.7|278/280|Pantoate_ligase| GO:PFM:NREP 2 GO:PFM GO:0004592|"GO:pantoate-beta-alanine ligase activity"|PF02569|IPR003721| GO:PFM GO:0015940|"GO:pantothenate biosynthetic process"|PF02569|IPR003721| RP:SCP:NREP 1 RP:SCP:REP 1->282|1ihoA|3e-54|84.4|282/282|c.26.1.4| HM:SCP:REP 1->282|1ihoA_|1.6e-105|52.1|282/282|c.26.1.4|1/1|Nucleotidylyl transferase| OP:NHOMO 855 OP:NHOMOORG 823 OP:PATTERN -------------------------------------------------------------------- 11-1111122211111111-111111111111111111111411111-111111111111111-1121111---------1-11111111111111---11111111111---------------111111111111111111111111111111111111111111111111111111111111111---111111111111111111111111111111111111111111-11111111111111111111---------------------------------------------------------------------1--111111111-1111111-----11---111111211--1111-11---11111111111114111111111111111111111-11111111111-111111111111111111-11111111111111111111111111---------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111-11111111111111111111111111111111111111111111111--11111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---111111111111111---------------11111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------11-1111111121 ----111-----11111111111111111111111111111111111111111111111111111111111111111-1111111111-1111111111112-111-111------------------------------------------------------------8----113141121111221121121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 99.6 SQ:SECSTR cEEEccHHHHHHHHHHHHHTTccEEEEEEcccccHHHHHHHHHHHTcTTEEEEEEccccccTTcccHHHHHHHcHHcHHHHHHHTTccEEEcccHHHHcTTcccccccccccGGGGcGGGTTcTTHHHHHHHHHHHHHHHHcccEEEEETTcHHHHHHHHHHHHHTTcccEEEEEcccccTTcccccGGGGGccHHHHHHTHHHHHHHHHHHHHGGGcHHHHHHHHHHHHHHHHcTTcEEEEEEEEETTcccccccccEEEEEEEEEEETTEEEEEEEEEEET# DISOP:02AL 284-285| PSIPRED cEEEccHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHccEEEEEEEEcHHHcccccHHHHccccHHHHHHHHHHccccEEEcccHHHccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEccEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccEEEEEEEEccccccccccccccEEEEEEEEEccEEEEEEEEEEccc //