[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : panD
DDBJ      :panD         aspartate 1-decarboxylase
Swiss-Prot:PAND_SALTY   RecName: Full=Aspartate 1-decarboxylase;         EC=4.1.1.11;AltName: Full=Aspartate alpha-decarboxylase;Contains:  RecName: Full=Aspartate 1-decarboxylase beta chain;Contains:  RecName: Full=Aspartate 1-decarboxylase alpha chain;Flags: Precursor;

Homologs  Archaea  3/68 : Bacteria  495/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.52.2
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->123 1pqfA PDBj 1e-62 95.1 %
:RPS:PDB   1->113 2c45A PDBj 5e-50 49.6 %
:RPS:SCOP  1->115 1aw8.1  b.52.2.1 * 1e-23 95.7 %
:HMM:SCOP  1->123 1uhe.1 b.52.2.1 * 6.5e-47 51.6 %
:RPS:PFM   1->115 PF02261 * Asp_decarbox 7e-37 57.4 %
:HMM:PFM   1->115 PF02261 * Asp_decarbox 2e-52 50.4 115/116  
:BLT:SWISS 1->126 PAND_SALTY 1e-69 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67092.1 GT:GENE panD GT:PRODUCT aspartate 1-decarboxylase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(218714..219094) GB:FROM 218714 GB:TO 219094 GB:DIRECTION - GB:GENE panD GB:PRODUCT aspartate 1-decarboxylase GB:NOTE identified by match to protein family HMM PF02261; match to protein family HMM TIGR00223 GB:PROTEIN_ID ACF67092.1 GB:DB_XREF GI:194406873 GB:GENE:GENE panD LENGTH 126 SQ:AASEQ MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPKVAYFEGDNEMKRTAKAIPVQVA GT:EXON 1|1-126:0| SW:ID PAND_SALTY SW:DE RecName: Full=Aspartate 1-decarboxylase; EC=4.1.1.11;AltName: Full=Aspartate alpha-decarboxylase;Contains: RecName: Full=Aspartate 1-decarboxylase beta chain;Contains: RecName: Full=Aspartate 1-decarboxylase alpha chain;Flags: Precursor; SW:GN Name=panD; OrderedLocusNames=STM0180; SW:KW Autocatalytic cleavage; Complete proteome; Cytoplasm; Decarboxylase;Lyase; Pantothenate biosynthesis; Pyruvate; Schiff base; Zymogen. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->126|PAND_SALTY|1e-69|100.0|126/126| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016831|"GO:carboxy-lyase activity"|Decarboxylase| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0015940|"GO:pantothenate biosynthetic process"|Pantothenate biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 1->123|1pqfA|1e-62|95.1|122/126| RP:PDB:NREP 1 RP:PDB:REP 1->113|2c45A|5e-50|49.6|113/113| RP:PFM:NREP 1 RP:PFM:REP 1->115|PF02261|7e-37|57.4|115/116|Asp_decarbox| HM:PFM:NREP 1 HM:PFM:REP 1->115|PF02261|2e-52|50.4|115/116|Asp_decarbox| GO:PFM:NREP 2 GO:PFM GO:0004068|"GO:aspartate 1-decarboxylase activity"|PF02261|IPR003190| GO:PFM GO:0006523|"GO:alanine biosynthetic process"|PF02261|IPR003190| RP:SCP:NREP 1 RP:SCP:REP 1->115|1aw8.1|1e-23|95.7|115/115|b.52.2.1| HM:SCP:REP 1->123|1uhe.1|6.5e-47|51.6|122/122|b.52.2.1|1/1|ADC-like| OP:NHOMO 513 OP:NHOMOORG 499 OP:PATTERN ---------------------11-----1--------------------------------------- ----1--11111-111111-111131111111111111111121--1-111-211111--111-1111111---------1--1111111111111---11111111111---------------11111111111-----1111-111-111----------11-21111------------11111---211111111111111111111111111111111111111121-11111111111111111111-----------1---------------------------------------------------------1--111111211-111-111-----11---111111211--1111-11---111111-----111---------------------------1---2---11---1------1111-----------------------11------------------------------------1111-1111111111111111111111111-1--111111-1111222-1111111111111111-----11---111-1-1----1-1---111111111111111111111-1111111111111111--1--1----1----------------------1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111----11111111111-11---------------1111111111111111---------1---1111111111--------------1111111111111111--111111------------------------------------11-1111111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 97.6 SQ:SECSTR cEEEcccEEEEEEEcccEEcccccEEEEEHHHHHHTTccccccEEEEETTTccEEEEcEEEEcTTTTcEEEEccTTTTccTTcEEEEEEccEEEHHHHHccccEEEEccTTccEccccTTccc### DISOP:02AL 125-127| PSIPRED cHHHHHHHEEcEEEEEccEEEEEEEEEEcHHHHHHcccccccEEEEEEcccccEEEEEEEEcccccEEEEEcHHHHcccccccEEEEEEEEcccHHHHHHcccEEEEEcccccEEEEEcccccEEc //