[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : pflA
DDBJ      :pflA         pyruvate formate-lyase 1-activating enzyme
Swiss-Prot:PFLA_SHIFL   RecName: Full=Pyruvate formate-lyase 1-activating enzyme;         EC=1.97.1.4;AltName: Full=PFL-activating enzyme 1;AltName: Full=Formate-C-acetyltransferase-activating enzyme 1;

Homologs  Archaea  6/68 : Bacteria  331/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.1.28d.218.1d.350.1
:265 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->265 3cb8A PDBj e-137 92.2 %
:RPS:PDB   22->265 3c8fA PDBj 2e-27 92.2 %
:RPS:SCOP  42->128 2h7aA1  d.350.1.1 * 7e-10 11.5 %
:RPS:SCOP  151->240 2o5aA1  d.218.1.12 * 2e-17 15.9 %
:HMM:SCOP  38->239 1tv8A_ c.1.28.3 * 4.6e-21 22.3 %
:RPS:PFM   47->198 PF04055 * Radical_SAM 1e-08 27.7 %
:HMM:PFM   43->197 PF04055 * Radical_SAM 1.1e-34 29.6 152/166  
:BLT:SWISS 22->265 PFLA_SHIFL e-137 92.2 %
:PROS 37->58|PS01087|RADICAL_ACTIVATING
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67396.1 GT:GENE pflA GT:PRODUCT pyruvate formate-lyase 1-activating enzyme GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1057079..1057876) GB:FROM 1057079 GB:TO 1057876 GB:DIRECTION - GB:GENE pflA GB:PRODUCT pyruvate formate-lyase 1-activating enzyme GB:NOTE identified by match to protein family HMM PF04055; match to protein family HMM TIGR02493 GB:PROTEIN_ID ACF67396.1 GB:DB_XREF GI:194407177 GB:GENE:GENE pflA LENGTH 265 SQ:AASEQ MSNLTDCITNESVAVTADKKPVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEITVEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLDVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAQYLSKKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYGHKVMY GT:EXON 1|1-265:0| SW:ID PFLA_SHIFL SW:DE RecName: Full=Pyruvate formate-lyase 1-activating enzyme; EC=1.97.1.4;AltName: Full=PFL-activating enzyme 1;AltName: Full=Formate-C-acetyltransferase-activating enzyme 1; SW:GN Name=pflA; OrderedLocusNames=SF0897, S0961; SW:KW 4Fe-4S; Carbohydrate metabolism; Complete proteome; Cytoplasm;Glucose metabolism; Iron; Iron-sulfur; Metal-binding; Oxidoreductase;S-adenosyl-L-methionine. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 22->265|PFLA_SHIFL|e-137|92.2|244/246| GO:SWS:NREP 8 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005975|"GO:carbohydrate metabolic process"|Carbohydrate metabolism| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006006|"GO:glucose metabolic process"|Glucose metabolism| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 37->58|PS01087|RADICAL_ACTIVATING|PDOC00834| SEG 137->150|delldvtdlvmldl| BL:PDB:NREP 1 BL:PDB:REP 22->265|3cb8A|e-137|92.2|244/244| RP:PDB:NREP 1 RP:PDB:REP 22->265|3c8fA|2e-27|92.2|244/245| RP:PFM:NREP 1 RP:PFM:REP 47->198|PF04055|1e-08|27.7|148/164|Radical_SAM| HM:PFM:NREP 1 HM:PFM:REP 43->197|PF04055|1.1e-34|29.6|152/166|Radical_SAM| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 2 RP:SCP:REP 42->128|2h7aA1|7e-10|11.5|87/109|d.350.1.1| RP:SCP:REP 151->240|2o5aA1|2e-17|15.9|82/108|d.218.1.12| HM:SCP:REP 38->239|1tv8A_|4.6e-21|22.3|193/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 588 OP:NHOMOORG 346 OP:PATTERN -----------------------1-----------------------------1----1-1---11-- -----11-----------------------------------------1-------------111------11111111--1------2232-4----------------------------------------------------1-1----11----------1------------------------1-1-111111212121112--22--1121----21111111-1111111111111111111--1---11-----22--1111----11122222222222222222222222222222222222221112222-6413444445454415334211321-11111-33-421112-----113-----------------1---3--1------------------------------------------------------------------2----------------------------------1--------------------------------------------------------1-----------1-1-6212-33213----12--11-2------------------------------------212-------11111111111121111211--1----------31111212223233322-2222223232232222223243121123132323322323223222222221-211111111111------------------111111122121111---------------------------------------11111111111211----------------------------------2-------------------------------1-----1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1151111---------4----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 244 STR:RPRED 92.1 SQ:SECSTR #####################ccEEEEEEEEEEcTTcccEEEEEEEcccccccTTcccGGGccTTccEEEcHHHHHHHHGGGHHHHTcTTcEEEEEEccGGGGHHHHHHHHHHHHTTTccEEEEEccccccccHHHHHHHHTccEEEEEcccccHHHHHHHHccccHHHHHHHHHHHHHTccEEEEEEEcTTTTccHHHHHHHHHHHHHHccEEEEEEEEcccccHHHHHHTTcccTTTTcccccHHHHHHHHHHHHTTTccccc DISOP:02AL 1-2| PSIPRED ccccccccccccccEEEcccccEEEEEEEEEEEEEccccEEEEEEEccccccccccccHHHccccccccccHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHccccEEEEEcccccHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHcccccEEEEEcccccccccHHHccccccccccccccHHHHHHHHHHHHHcccEEEc //