[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : pncB
DDBJ      :pncB         nicotinate phosphoribosyltransferase
Swiss-Prot:PNCB_SALHS   RecName: Full=Nicotinate phosphoribosyltransferase;         Short=NAPRTase;         EC=2.4.2.11;

Homologs  Archaea  4/68 : Bacteria  271/915 : Eukaryota  93/199 : Viruses  0/175   --->[See Alignment]
c.1.17d.41.2
:400 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->373 1yirA PDBj e-111 52.4 %
:RPS:PDB   9->396 2e5bA PDBj 2e-66 15.5 %
:RPS:SCOP  5->136 1vlpA1  d.41.2.2 * 1e-44 32.6 %
:RPS:SCOP  150->392 1vlpA2  c.1.17.2 * 9e-67 34.7 %
:HMM:SCOP  1->140 1yirA2 d.41.2.2 * 1.3e-41 36.4 %
:HMM:SCOP  120->394 1ybeA1 c.1.17.2 * 3e-87 46.6 %
:RPS:PFM   171->387 PF04095 * NAPRTase 3e-25 42.2 %
:HMM:PFM   169->394 PF04095 * NAPRTase 2.5e-80 42.3 220/245  
:BLT:SWISS 1->400 PNCB_SALHS 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70112.1 GT:GENE pncB GT:PRODUCT nicotinate phosphoribosyltransferase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1101200..1102402) GB:FROM 1101200 GB:TO 1102402 GB:DIRECTION - GB:GENE pncB GB:PRODUCT nicotinate phosphoribosyltransferase GB:NOTE identified by match to protein family HMM PF04095; match to protein family HMM TIGR01514 GB:PROTEIN_ID ACF70112.1 GB:DB_XREF GI:194409893 GB:GENE:GENE pncB LENGTH 400 SQ:AASEQ MTQFASPVLHSLLDTDAYKLHMQQAVFHHYYDVQVAAEFRCRGDDLLGIYADAIREQVDAMQHLRLQEDEFQWLSGLPFFKPDYLNWLREFRYNPDQVCVTNDNGKLHIRLTGPWREVIMWEVPLLAVISELVHHYRSPNAGVDQALDALESKLVDFTALTADLDMSRFHLMDFGTRRRFSREVQQAIVKRLQQESWFVGTSNYDLARRLALTPMGTQAHEWFQAHQQISPDLATSQRAALAAWLNEYPDQLGIALTDCITMDAFLRDFGIEFASRYQGLRHDSGDPVAWGEKAIAHYEKLGIDPLTKTLVFSDNLDLQKAVELYRHFASRVQLSFGIGTRLTCDIPQVKPLNIVIKLVECNGKPVAKLSDSPGKTICHDKAFVRALRKAFDLPQVRKAS GT:EXON 1|1-400:0| SW:ID PNCB_SALHS SW:DE RecName: Full=Nicotinate phosphoribosyltransferase; Short=NAPRTase; EC=2.4.2.11; SW:GN Name=pncB; OrderedLocusNames=SeHA_C1106; SW:KW Complete proteome; Cytoplasm; Glycosyltransferase;Pyridine nucleotide biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->400|PNCB_SALHS|0.0|100.0|400/400| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016757|"GO:transferase activity, transferring glycosyl groups"|Glycosyltransferase| GO:SWS GO:0019363|"GO:pyridine nucleotide biosynthetic process"|Pyridine nucleotide biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 4->373|1yirA|e-111|52.4|370/390| RP:PDB:NREP 1 RP:PDB:REP 9->396|2e5bA|2e-66|15.5|373/466| RP:PFM:NREP 1 RP:PFM:REP 171->387|PF04095|3e-25|42.2|204/227|NAPRTase| HM:PFM:NREP 1 HM:PFM:REP 169->394|PF04095|2.5e-80|42.3|220/245|NAPRTase| RP:SCP:NREP 2 RP:SCP:REP 5->136|1vlpA1|1e-44|32.6|132/149|d.41.2.2| RP:SCP:REP 150->392|1vlpA2|9e-67|34.7|242/266|c.1.17.2| HM:SCP:REP 1->140|1yirA2|1.3e-41|36.4|140/0|d.41.2.2|1/1|Nicotinate/Quinolinate PRTase N-terminal domain-like| HM:SCP:REP 120->394|1ybeA1|3e-87|46.6|253/0|c.1.17.2|1/1|Nicotinate/Quinolinate PRTase C-terminal domain-like| OP:NHOMO 389 OP:NHOMOORG 368 OP:PATTERN -------------------------------------------------1111--------------- 1-----------------------------------------------------------------1------------------1-1111---11---111-1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------1------111111--1111-----1-11111111111-1111111111-111111111111111---1111111111---------------------------------------------------111111112111111111111111111111111--111--211221-2111-----1-1111111--------11----------------1-1-------------1------------------1---111-------1--------------------------1--1111111111111111-111-1111111111111111111111111111111111111111111111111111-111111111111----------------1----------------1111111111--22222212111121111-------------11111111-111111111---1111---1------------------------------------------------------- --------211---111111111111111111111111111111111111111111111111111111-11211111-1111111111-12-121-1111111122----------------------------------------------------1----1-------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 393 STR:RPRED 98.2 SQ:SECSTR ###cccccccGGGcccGGGGGGGGTccTTEEEEEEEEEEEEcccccEEEcccHHHHHHHHTccccccHHHHHHHHHHccccHHHHHHHHHHHTTcccEEEEEEcccEEEEEEEccGGGTTHHHHTHHHHHTTHHTTHHHHHHHHHHHHHHHHHHHHHHHHHcccTTGGGcEEEccTTTcccHHHHHHHHHHHTTTTTccccccTHHHHHHHHcccccccHHHHHTTcTHHHccGGGHHHHHHHHHHHTccccEEEEcccccHHHHHHTcTTccTTccEEEEcccccHHHHHHHHHHHHHHHcEccTTEEEEEcccccHHHHHHHHHHHccGGGEEEEEcHHHHTTcccTTTTTEEEEEEEETTEEEEcccccGGGcccccccEEEEcTTccEEEEc#### DISOP:02AL 1-2,398-401| PSIPRED ccccccHHHHcHHHccHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHcccccEEEEEEccccEEEEEEEccHHHEEHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHHcccccEEEEEEcccEEEcccccccccEEEEEEEEccEEEEEEccccccccccHHHHHHHHHHHcccccccccc //