[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : proC
DDBJ      :proC         pyrroline-5-carboxylate reductase
Swiss-Prot:P5CR_SHIFL   RecName: Full=Pyrroline-5-carboxylate reductase;         Short=P5C reductase;         Short=P5CR;         EC=1.5.1.2;

Homologs  Archaea  32/68 : Bacteria  787/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->267 2izzE PDBj 8e-43 38.2 %
:RPS:PDB   4->266 2ahrA PDBj 7e-24 27.7 %
:RPS:SCOP  4->162 2ahrA2  c.2.1.6 * 2e-33 29.8 %
:RPS:SCOP  162->268 1yqgA1  a.100.1.10 * 1e-35 31.8 %
:HMM:SCOP  3->161 1xc2A2 c.2.1.6 * 2e-37 38.2 %
:HMM:SCOP  161->271 1xc2A1 a.100.1.10 * 3.2e-36 49.5 %
:RPS:PFM   4->99 PF03807 * F420_oxidored 2e-11 46.3 %
:HMM:PFM   4->99 PF03807 * F420_oxidored 1.2e-25 39.4 94/96  
:BLT:SWISS 1->269 P5CR_SHIFL e-139 91.8 %
:PROS 222->244|PS00521|P5CR
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68825.1 GT:GENE proC GT:PRODUCT pyrroline-5-carboxylate reductase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(486391..487200) GB:FROM 486391 GB:TO 487200 GB:DIRECTION - GB:GENE proC GB:PRODUCT pyrroline-5-carboxylate reductase GB:NOTE identified by match to protein family HMM PF03446; match to protein family HMM PF03807; match to protein family HMM TIGR00112 GB:PROTEIN_ID ACF68825.1 GB:DB_XREF GI:194408606 GB:GENE:GENE proC LENGTH 269 SQ:AASEQ MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAALHDQYGINAAQSAQEVAQVADIVFGAVKPGIMVKVLSEISSSLNKDSLVVSIAAGVTLDQLARALGHDRKIIRAMPNTPSLVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEPMIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGKHPGELKDMVCSPGGTTIEAVRVLEERGFRAAVIEAMTKCMEKSEALSKS GT:EXON 1|1-269:0| SW:ID P5CR_SHIFL SW:DE RecName: Full=Pyrroline-5-carboxylate reductase; Short=P5C reductase; Short=P5CR; EC=1.5.1.2; SW:GN Name=proC; OrderedLocusNames=SF0322, S0330; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm; NADP;Oxidoreductase; Proline biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->269|P5CR_SHIFL|e-139|91.8|269/269| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006561|"GO:proline biosynthetic process"|Proline biosynthesis| PROS 222->244|PS00521|P5CR|PDOC00451| SEG 53->64|aaqsaqevaqva| BL:PDB:NREP 1 BL:PDB:REP 5->267|2izzE|8e-43|38.2|262/272| RP:PDB:NREP 1 RP:PDB:REP 4->266|2ahrA|7e-24|27.7|249/250| RP:PFM:NREP 1 RP:PFM:REP 4->99|PF03807|2e-11|46.3|95/96|F420_oxidored| HM:PFM:NREP 1 HM:PFM:REP 4->99|PF03807|1.2e-25|39.4|94/96|F420_oxidored| RP:SCP:NREP 2 RP:SCP:REP 4->162|2ahrA2|2e-33|29.8|151/152|c.2.1.6| RP:SCP:REP 162->268|1yqgA1|1e-35|31.8|107/111|a.100.1.10| HM:SCP:REP 3->161|1xc2A2|2e-37|38.2|152/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 161->271|1xc2A1|3.2e-36|49.5|111/0|a.100.1.10|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1376 OP:NHOMOORG 1010 OP:PATTERN 11---11-1111111111---------111-1--1--------------1111--1-11211111--- 11-1111111111111111-1111111111111111111111111111111111111111111111111111111211--11111111112111-------112211111--------------1111111111111111111111111111111111111111111212111111111111111111211123434344343344444334434443221-1112222123211111111111111111111211-11-1---1122111111111111111111111111111111111111111111111111111111111111111111111112221111211--211111111111-111111--11111111-----111111111111111111111111-11111211111-4112221222211121211211111111111111111111111----1-------------------------111-21221-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111-111111111--111-1111111111111111111111111112111112111111--11111------11211111111111111-11111111111111111111211111111111111111111111111111111111111111111--1111111111111111111111-1111111122222111111111111111121111111111111111111111111111111111111111111111111111111---------1-----1---------------------11--11111121 11-1222-311-111223242215343111111-11111111-111232333632231211111111111111111111111111111-13121111111111212-13144533222211133432B3GZ4-8571323343321322132133222123312122325B22312112F1112211212112121112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 269 STR:RPRED 100.0 SQ:SECSTR cHcEEEEEcccHHHHHHHHHTTcccEEEHcEEEEEcccHHHHHHHHTHHHTcccccHHHHHHTccEEEEcccGGGHHHHHHHHHTTccccccEEEccTccHHHHHHHHTTccTTccEEEEccGGGGTcEEEEEEEcTTccHHHHHHHHHHHHTTEEEEEccGGGHHHHHHHHTTHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccTTcHHHHHHHGHHHHTHHHHHHHHHHHHHHHHHHcTcT DISOP:02AL 1-1,267-270| PSIPRED cccEEEEEcccHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHccEEEccHHHHHccccEEEEEccHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHccccccEEEEEccccHHHcccEEEEEccccccHHHHHHHHHHHHHccEEEEEcHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcc //