[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : prpC
DDBJ      :prpC         2-methylcitrate synthase
Swiss-Prot:PRPC_SALTY   RecName: Full=2-methylcitrate synthase;         EC=2.3.3.5;AltName: Full=Methylcitrate synthase;AltName: Full=Citrate synthase 2;

Homologs  Archaea  38/68 : Bacteria  713/915 : Eukaryota  151/199 : Viruses  0/175   --->[See Alignment]
a.103.1
:389 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->381 1a59A PDBj 1e-73 41.8 %
:RPS:PDB   22->388 1aj8B PDBj e-122 39.0 %
:RPS:SCOP  15->384 1a59A  a.103.1.1 * e-126 41.6 %
:HMM:SCOP  18->388 1aj8A_ a.103.1.1 * 2e-132 44.0 %
:RPS:PFM   42->370 PF00285 * Citrate_synt 4e-79 46.2 %
:HMM:PFM   22->370 PF00285 * Citrate_synt 4.9e-119 44.0 348/356  
:BLT:SWISS 1->389 PRPC_SALTY 0.0 98.7 %
:PROS 271->283|PS00480|CITRATE_SYNTHASE

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70240.1 GT:GENE prpC GT:PRODUCT 2-methylcitrate synthase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 466115..467284 GB:FROM 466115 GB:TO 467284 GB:DIRECTION + GB:GENE prpC GB:PRODUCT 2-methylcitrate synthase GB:NOTE identified by match to protein family HMM PF00285; match to protein family HMM TIGR01800 GB:PROTEIN_ID ACF70240.1 GB:DB_XREF GI:194410021 GB:GENE:GENE prpC LENGTH 389 SQ:AASEQ MTDTTILQNNTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYRGYDILDLAEHCEFEEVAHLLIHGKLPTRDELNAYKSKLKALRGLPANVRTVLEALPAASHPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPETDDDSIGGHFLHLLHGEKPTQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDVYSAIIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVENKEVVIGFGHPVYTIADPRHQVIKRVAKQLSEEGGSLKMYHIADRLETVMWETKKMFPNLDWFSAVSYNMMGVPTEMFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYTGPDDRQFVPIEKRC GT:EXON 1|1-389:0| SW:ID PRPC_SALTY SW:DE RecName: Full=2-methylcitrate synthase; EC=2.3.3.5;AltName: Full=Methylcitrate synthase;AltName: Full=Citrate synthase 2; SW:GN Name=prpC; OrderedLocusNames=STM0369; SW:KW Complete proteome; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->389|PRPC_SALTY|0.0|98.7|389/389| GO:SWS:NREP 1 GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 271->283|PS00480|CITRATE_SYNTHASE|PDOC00422| BL:PDB:NREP 1 BL:PDB:REP 15->381|1a59A|1e-73|41.8|366/377| RP:PDB:NREP 1 RP:PDB:REP 22->388|1aj8B|e-122|39.0|362/370| RP:PFM:NREP 1 RP:PFM:REP 42->370|PF00285|4e-79|46.2|327/347|Citrate_synt| HM:PFM:NREP 1 HM:PFM:REP 22->370|PF00285|4.9e-119|44.0|348/356|Citrate_synt| GO:PFM:NREP 2 GO:PFM GO:0044262|"GO:cellular carbohydrate metabolic process"|PF00285|IPR002020| GO:PFM GO:0046912|"GO:transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer"|PF00285|IPR002020| RP:SCP:NREP 1 RP:SCP:REP 15->384|1a59A|e-126|41.6|368/377|a.103.1.1| HM:SCP:REP 18->388|1aj8A_|2e-132|44.0|366/371|a.103.1.1|1/1|Citrate synthase| OP:NHOMO 1511 OP:NHOMOORG 902 OP:PATTERN 11----2111111112-1222111111112111-2---------------111--1-----221--11 1131221233321232333-32113333333322222353232223211221322223--222222333411111111-1113111221111-1-----11111111111--------------11111111111111111---42211111111111111111111111111111111111112111---21322222222222222232332322211112111111112211111111111111111111-----------------------1-1-------111------------------------111111111----------------1-111---1-11-132--111------1------11-1222311111213331122211111111111112-11111112233134411213231111131112111111122222222211111221111111111--11111111111111111111211222222332232222222552222-223736321133211122321123224112122222222211211121322-1--21----221121211111123-22111111111-12111111111--111221221222232222222222222222222---2222------21111112222222222-2212222222222221222222222312222222222222222111111111-111111111111--1222222222212222-----1-----11112221222222212222222222222222211111111111113222222222222222222221111111-222222-------------------------------------1---1-111111 1---44--52--4441311111-2212-------------------12112222122-122221-121-13-1112222211111111-32232321111211121-213212111--111121211111E2-112-1113-11111-1-111-1--111-111111313711214143f22212433316411----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 377 STR:RPRED 96.9 SQ:SECSTR ###########ccccccccGGcTTccccccccEEEETTTTEEEETTEEHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHTTccccHHHHHHHHHccTTccHHHHHHHHHHHHHHHcTTTTccccHHHHHHHHHHHHHHHHHHHHHHHHTTTccccccccTTccHHHHHHHHHHTccccHHHHHHHHHHHHHHccccccHHHHHHHHHHTTTccHHHHHHHHHHHHTcTTTTTHHHHHHHHHHHHccTTTHHHHHHHHHHTTcccTTccccccccccHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHGGTccccTTTTHHHHHHHTTccGGGHHHHHHHHHHHHHHHHHHHHGGGccccccccccccccccccccGGGc# DISOP:02AL 1-1| PSIPRED cccccccccccccccccccccccccEEEEEEEEEEEccccEEEEccEEHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHcc //