[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : rcsA
DDBJ      :rcsA         colanic acid capsular biosynthesis activation protein A
Swiss-Prot:RCSA_SALTY   RecName: Full=Colanic acid capsular biosynthesis activation protein A;

Homologs  Archaea  0/68 : Bacteria  67/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.47.1
:207 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   142->193 2jpcA PDBj 3e-04 30.8 %
:RPS:PDB   66->193 3c3wB PDBj 2e-08 18.0 %
:RPS:SCOP  29->127 1a0rP  c.47.1.6 * 3e-04 19.2 %
:RPS:SCOP  137->185 1p4wA  a.4.6.2 * 2e-08 34.7 %
:HMM:SCOP  116->198 1p4wA_ a.4.6.2 * 3.5e-09 24.1 %
:RPS:PFM   136->185 PF00196 * GerE 4e-07 40.0 %
:HMM:PFM   137->191 PF00196 * GerE 4.8e-21 32.7 55/58  
:BLT:SWISS 1->207 RCSA_SALTY e-116 100.0 %
:PROS 152->179|PS00622|HTH_LUXR_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70458.1 GT:GENE rcsA GT:PRODUCT colanic acid capsular biosynthesis activation protein A GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2115047..2115670 GB:FROM 2115047 GB:TO 2115670 GB:DIRECTION + GB:GENE rcsA GB:PRODUCT colanic acid capsular biosynthesis activation protein A GB:NOTE identified by match to protein family HMM PF00196 GB:PROTEIN_ID ACF70458.1 GB:DB_XREF GI:194410239 GB:GENE:GENE rcsA LENGTH 207 SQ:AASEQ MSTIIMDLCSYTRLGLSGYLVSRGVKKREINDIETVDELAIACGAHQPSVVFINEDCFIHTPSDSQQIKQIINQHPDTLFIVFMAIANVHFDEYLLVRKNLLISSKSIKPDSLDTLLGDILKKESGISGTINLPTLSLSRTESSMLRMWMEGQGTIQISDRMNIKAKTVSSHKGNIKRKIKTHNKQVIYHVVRLTDNVTNGIFVNMR GT:EXON 1|1-207:0| SW:ID RCSA_SALTY SW:DE RecName: Full=Colanic acid capsular biosynthesis activation protein A; SW:GN Name=rcsA; OrderedLocusNames=STM1982; SW:KW Activator; Capsule biogenesis/degradation; Complete proteome;DNA-binding; Sensory transduction; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->207|RCSA_SALTY|e-116|100.0|207/207| GO:SWS:NREP 4 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0050896|"GO:response to stimulus"|Sensory transduction| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 152->179|PS00622|HTH_LUXR_1|PDOC00542| BL:PDB:NREP 1 BL:PDB:REP 142->193|2jpcA|3e-04|30.8|52/61| RP:PDB:NREP 1 RP:PDB:REP 66->193|3c3wB|2e-08|18.0|128/210| RP:PFM:NREP 1 RP:PFM:REP 136->185|PF00196|4e-07|40.0|50/57|GerE| HM:PFM:NREP 1 HM:PFM:REP 137->191|PF00196|4.8e-21|32.7|55/58|GerE| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 29->127|1a0rP|3e-04|19.2|99/188|c.47.1.6| RP:SCP:REP 137->185|1p4wA|2e-08|34.7|49/87|a.4.6.2| HM:SCP:REP 116->198|1p4wA_|3.5e-09|24.1|83/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 69 OP:NHOMOORG 67 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---211111111111-1111111111111-11--1111---1-1111111111111111111-11112--1111-1111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 130 STR:RPRED 62.8 SQ:SECSTR #################################################################HHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGcHHHHccTTTTccHHHHHHHHHHTTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHTH############ DISOP:02AL 120-137,207-208| PSIPRED cEEEEEcccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccEEEEEc //