[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : rcsB
DDBJ      :rcsB         capsular synthesis regulator component B
Swiss-Prot:RCSB_SALTY   RecName: Full=Capsular synthesis regulator component B;

Homologs  Archaea  0/68 : Bacteria  642/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->127 3eulB PDBj 2e-11 28.1 %
:BLT:PDB   129->215 1p4wA PDBj 6e-41 90.8 %
:RPS:PDB   4->211 3c3wB PDBj 3e-25 22.0 %
:RPS:SCOP  3->138 1a04A2  c.23.1.1 * 6e-15 26.3 %
:RPS:SCOP  129->215 1p4wA  a.4.6.2 * 1e-11 90.8 %
:HMM:SCOP  1->137 1k66A_ c.23.1.1 * 7.6e-20 23.9 %
:HMM:SCOP  129->215 1p4wA_ a.4.6.2 * 6e-16 33.3 %
:RPS:PFM   6->120 PF00072 * Response_reg 7e-06 27.3 %
:RPS:PFM   151->204 PF00196 * GerE 4e-09 46.3 %
:HMM:PFM   6->120 PF00072 * Response_reg 1.1e-26 32.4 111/112  
:HMM:PFM   149->204 PF00196 * GerE 4.1e-21 39.3 56/58  
:BLT:SWISS 1->216 RCSB_SALTY e-119 100.0 %
:PROS 165->192|PS00622|HTH_LUXR_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69972.1 GT:GENE rcsB GT:PRODUCT capsular synthesis regulator component B GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2417557..2418207 GB:FROM 2417557 GB:TO 2418207 GB:DIRECTION + GB:GENE rcsB GB:PRODUCT capsular synthesis regulator component B GB:NOTE identified by match to protein family HMM PF00072; match to protein family HMM PF00196 GB:PROTEIN_ID ACF69972.1 GB:DB_XREF GI:194409753 GB:GENE:GENE rcsB LENGTH 216 SQ:AASEQ MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVTLSPTDKE GT:EXON 1|1-216:0| SW:ID RCSB_SALTY SW:DE RecName: Full=Capsular synthesis regulator component B; SW:GN Name=rcsB; OrderedLocusNames=STM2270; SW:KW Activator; Capsule biogenesis/degradation; Complete proteome;DNA-binding; Phosphoprotein; Transcription; Transcription regulation;Two-component regulatory system. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->216|RCSB_SALTY|e-119|100.0|216/216| GO:SWS:NREP 4 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|Two-component regulatory system| PROS 165->192|PS00622|HTH_LUXR_1|PDOC00542| BL:PDB:NREP 2 BL:PDB:REP 4->127|3eulB|2e-11|28.1|121/124| BL:PDB:REP 129->215|1p4wA|6e-41|90.8|87/87| RP:PDB:NREP 1 RP:PDB:REP 4->211|3c3wB|3e-25|22.0|205/210| RP:PFM:NREP 2 RP:PFM:REP 6->120|PF00072|7e-06|27.3|110/111|Response_reg| RP:PFM:REP 151->204|PF00196|4e-09|46.3|54/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 6->120|PF00072|1.1e-26|32.4|111/112|Response_reg| HM:PFM:REP 149->204|PF00196|4.1e-21|39.3|56/58|GerE| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 3->138|1a04A2|6e-15|26.3|133/138|c.23.1.1| RP:SCP:REP 129->215|1p4wA|1e-11|90.8|87/87|a.4.6.2| HM:SCP:REP 1->137|1k66A_|7.6e-20|23.9|134/149|c.23.1.1|1/1|CheY-like| HM:SCP:REP 129->215|1p4wA_|6e-16|33.3|87/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 2453 OP:NHOMOORG 645 OP:PATTERN -------------------------------------------------------------------- 48A1B133111-2-2-111-13--3411111252335986256C33-222124331----23658C8AEC41111311-11-6-----11----11---4-7132H3C33--------------------------56667566A6511411111------1--315657-------------36332--2245555554763655554745545586-31521122222275433333333333333344431---11-1--11112111---1-1111111-113221111111111111111111111113121112221141611111111-1-11------1-11-7111-64112123-11111---511211------14B361-23355622222222222-64447864143-32233232323411---1-21212113-------------4---------------------------------1---42111A459B76655388CG999A388AA9CDF-18875844466544335266354-1111111-1344522511-42122111-2-431432322222341------------------------1--651521614414323415333335446343----322------85455746885754577-8777656666857556445555675528777787788777777656655653-977777677777--4344444111112522111112-1111-1122222222--142BBCA8C98766763787---------123354555526445CC979764452222--1-331111----------------------------------------------3D- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 215 STR:RPRED 99.5 SQ:SECSTR cccEEEEEEcccHHHHHHHHHHHHTcTTEEEEEEEccHHHHHHHHHHHcccEEEEccEETTEccEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHHHccTccHHHHHHHHHHTTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHTcccccc# DISOP:02AL 1-1,135-152,213-217| PSIPRED cccEEEEEEccHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHcccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccc //