[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : rcsF
DDBJ      :rcsF         exopolysaccharide synthesis regulator RcsF
Swiss-Prot:RCSF_ECOLI   RecName: Full=Protein rcsF;

Homologs  Archaea  0/68 : Bacteria  81/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   86->128 PF01906 * DUF74 0.00045 23.3 43/105  
:BLT:SWISS 1->134 RCSF_ECOLI 5e-58 93.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68237.1 GT:GENE rcsF GT:PRODUCT exopolysaccharide synthesis regulator RcsF GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(292729..293133) GB:FROM 292729 GB:TO 293133 GB:DIRECTION - GB:GENE rcsF GB:PRODUCT exopolysaccharide synthesis regulator RcsF GB:PROTEIN_ID ACF68237.1 GB:DB_XREF GI:194408018 GB:GENE:GENE rcsF LENGTH 134 SQ:AASEQ MRALPICLLALMLGGCSMLSRSPVEPVQSTATPPKAEPEKPKAPRAAPVRIYTNAEDLVGKPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMKANAVLLHSCEITSGTPGCYRQAVCIGSALNISAK GT:EXON 1|1-134:0| SW:ID RCSF_ECOLI SW:DE RecName: Full=Protein rcsF; SW:GN Name=rcsF; OrderedLocusNames=b0196, JW0192; SW:KW Capsule biogenesis/degradation; Cell membrane; Cell outer membrane;Complete proteome; Membrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->134|RCSF_ECOLI|5e-58|93.3|134/134| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0009279|"GO:cell outer membrane"|Cell outer membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| TM:NTM 1 TM:REGION 1->23| SEG 30->48|tatppkaepekpkapraap| HM:PFM:NREP 1 HM:PFM:REP 86->128|PF01906|0.00045|23.3|43/105|DUF74| OP:NHOMO 81 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,22-48,75-84,133-135| PSIPRED cccHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEccHHHHccccHHHHccccccEEEEccccccccHHHHHHHHHHHHHHccccEEEEEEEEEEcccccHHHEEEHHccEEHcccc //