[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : rplS
DDBJ      :rplS         ribosomal protein L19
Swiss-Prot:RL19_SALTY   RecName: Full=50S ribosomal protein L19;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  25/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->115 1vs6P PDBj 4e-60 97.4 %
:RPS:PDB   3->111 3bboR PDBj 1e-35 37.0 %
:RPS:SCOP  2->115 2j01T1  b.34.5.6 * 8e-40 45.6 %
:HMM:SCOP  2->115 2gyaN1 b.34.5.6 * 1.8e-42 61.4 %
:RPS:PFM   5->114 PF01245 * Ribosomal_L19 9e-34 70.9 %
:HMM:PFM   3->113 PF01245 * Ribosomal_L19 5.3e-53 63.1 111/113  
:BLT:SWISS 1->115 RL19_SALTY 1e-61 100.0 %
:PROS 86->101|PS01015|RIBOSOMAL_L19

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67630.1 GT:GENE rplS GT:PRODUCT ribosomal protein L19 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2823070..2823417) GB:FROM 2823070 GB:TO 2823417 GB:DIRECTION - GB:GENE rplS GB:PRODUCT ribosomal protein L19 GB:NOTE identified by match to protein family HMM PF01245; match to protein family HMM TIGR01024 GB:PROTEIN_ID ACF67630.1 GB:DB_XREF GI:194407411 GB:GENE:GENE rplS LENGTH 115 SQ:AASEQ MSNIIKQLEQEQMKQNVPSFRPGDTVEVKVWVVEGTKKRLQAFEGVVIAIRNRGLHSAFTVRKISNGEGVERVFQTHSPVVDSIAVKRRGAVRKAKLYYLRERTGKAARIKERLN GT:EXON 1|1-115:0| SW:ID RL19_SALTY SW:DE RecName: Full=50S ribosomal protein L19; SW:GN Name=rplS; OrderedLocusNames=STM2673; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->115|RL19_SALTY|1e-61|100.0|115/115| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 86->101|PS01015|RIBOSOMAL_L19|PDOC00778| BL:PDB:NREP 1 BL:PDB:REP 2->115|1vs6P|4e-60|97.4|114/114| RP:PDB:NREP 1 RP:PDB:REP 3->111|3bboR|1e-35|37.0|108/113| RP:PFM:NREP 1 RP:PFM:REP 5->114|PF01245|9e-34|70.9|110/112|Ribosomal_L19| HM:PFM:NREP 1 HM:PFM:REP 3->113|PF01245|5.3e-53|63.1|111/113|Ribosomal_L19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01245|IPR001857| GO:PFM GO:0005622|"GO:intracellular"|PF01245|IPR001857| GO:PFM GO:0005840|"GO:ribosome"|PF01245|IPR001857| GO:PFM GO:0006412|"GO:translation"|PF01245|IPR001857| RP:SCP:NREP 1 RP:SCP:REP 2->115|2j01T1|8e-40|45.6|114/137|b.34.5.6| HM:SCP:REP 2->115|2gyaN1|1.8e-42|61.4|114/0|b.34.5.6|1/1|Translation proteins SH3-like domain| OP:NHOMO 966 OP:NHOMOORG 932 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111111111111111111111111 -------------------------------------------------------------------------------------------------------111--------------------------------------------------------------------11112E222113253-52--11111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 99.1 SQ:SECSTR #cccTTHHHHTTccccccccccccccccccccccccccccccccccccccccccccccccccccccccTTTcccccccccccccccccccccccccccccccccTTccccccccc DISOP:02AL 1-1,115-116| PSIPRED cHHHHHHHHHHHHHccccccccccEEEEEEEEEcccEEEEEEEEEEEEEEcccccccEEEEEEcccccEEEEEEEcccccEEEEEEEEEEccHHHHHHHHHcccccEEEEEEEcc //