[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : rplY
DDBJ      :rplY         ribosomal L25p family
Swiss-Prot:RL25_SALTY   RecName: Full=50S ribosomal protein L25;

Homologs  Archaea  0/68 : Bacteria  353/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.53.1
:94 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->94 1dfuP PDBj 9e-47 91.5 %
:RPS:PDB   1->94 1dfuP PDBj 1e-31 91.5 %
:RPS:SCOP  1->94 1dfuP  b.53.1.1 * 1e-31 91.5 %
:HMM:SCOP  1->94 1dfuP_ b.53.1.1 * 2.3e-29 46.8 %
:RPS:PFM   4->91 PF01386 * Ribosomal_L25p 1e-21 54.5 %
:HMM:PFM   4->91 PF01386 * Ribosomal_L25p 3.4e-32 44.3 88/88  
:BLT:SWISS 1->94 RL25_SALTY 9e-50 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70471.1 GT:GENE rplY GT:PRODUCT ribosomal L25p family GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2374020..2374304 GB:FROM 2374020 GB:TO 2374304 GB:DIRECTION + GB:GENE rplY GB:PRODUCT ribosomal L25p family GB:NOTE identified by match to protein family HMM PF01386 GB:PROTEIN_ID ACF70471.1 GB:DB_XREF GI:194410252 GB:GENE:GENE rplY LENGTH 94 SQ:AASEQ MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEVKVKAQAVQRHAYKPKLTHIDFVRA GT:EXON 1|1-94:0| SW:ID RL25_SALTY SW:DE RecName: Full=50S ribosomal protein L25; SW:GN Name=rplY; OrderedLocusNames=STM2224; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->94|RL25_SALTY|9e-50|100.0|94/94| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 1->94|1dfuP|9e-47|91.5|94/94| RP:PDB:NREP 1 RP:PDB:REP 1->94|1dfuP|1e-31|91.5|94/94| RP:PFM:NREP 1 RP:PFM:REP 4->91|PF01386|1e-21|54.5|88/88|Ribosomal_L25p| HM:PFM:NREP 1 HM:PFM:REP 4->91|PF01386|3.4e-32|44.3|88/88|Ribosomal_L25p| GO:PFM:NREP 5 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01386|IPR020055| GO:PFM GO:0005622|"GO:intracellular"|PF01386|IPR020055| GO:PFM GO:0005840|"GO:ribosome"|PF01386|IPR020055| GO:PFM GO:0006412|"GO:translation"|PF01386|IPR020055| GO:PFM GO:0008097|"GO:5S rRNA binding"|PF01386|IPR020055| RP:SCP:NREP 1 RP:SCP:REP 1->94|1dfuP|1e-31|91.5|94/94|b.53.1.1| HM:SCP:REP 1->94|1dfuP_|2.3e-29|46.8|94/94|b.53.1.1|1/1|Ribosomal protein L25-like| OP:NHOMO 353 OP:NHOMOORG 353 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------1--------1------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1------111111------------11111111111---------111-111111111111--1---1111111----------------1-11--1-------1111111111111-----11111111111111111111111111111111111111111111111111111111111111-1111111111111-----------------------------------------------------------1111111111111111111111111111111-111-111-11111111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111-1111111111111111111111111111111111111111111111111-11111111---111111111111111111111111111111111-111111--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 100.0 SQ:SECSTR ccEEEcEEcccccHHHHHHHHHTTEEEEEEEccccccEEEEEEHHHHHHHTTcGGGGTcccEEEETTEEccEEEEEEEEccccccEEEEEEEEc DISOP:02AL 11-17| PSIPRED cEEEEEEEEcccccHHHHHHHHcccccEEEEccccccEEEEEcHHHHHHHHHcccccEEEEEEEEccEEEEEEEEEEEcccccccEEEEEEEcc //