[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : rpmJ
DDBJ      :rpmJ         ribosomal protein L36
Swiss-Prot:RL36_SALSV   RecName: Full=50S ribosomal protein L36;

Homologs  Archaea  0/68 : Bacteria  137/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.42.1
:46 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->41 3bbo6 PDBj 1e-05 60.0 %
:RPS:PDB   1->41 3bbo6 PDBj 2e-06 50.0 %
:HMM:SCOP  1->41 2i2t41 g.42.1.1 * 9.2e-12 63.2 %
:HMM:PFM   1->41 PF00444 * Ribosomal_L36 5.9e-22 63.2 38/38  
:BLT:SWISS 1->46 RL36_SALSV 2e-23 100.0 %
:PROS 14->40|PS00828|RIBOSOMAL_L36

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF67846.1 GT:GENE rpmJ GT:PRODUCT ribosomal protein L36 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 573742..573882 GB:FROM 573742 GB:TO 573882 GB:DIRECTION + GB:GENE rpmJ GB:PRODUCT ribosomal protein L36 GB:NOTE identified by match to protein family HMM TIGR01022 GB:PROTEIN_ID ACF67846.1 GB:DB_XREF GI:194407627 GB:GENE:GENE rpmJ LENGTH 46 SQ:AASEQ MQVLNSLRNAKQRHPDCQIVKRKGRLYVICKTNPRFKAVQGRKKRR GT:EXON 1|1-46:0| SW:ID RL36_SALSV SW:DE RecName: Full=50S ribosomal protein L36; SW:GN Name=rpmJ; OrderedLocusNames=SeSA_A0530; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->46|RL36_SALSV|2e-23|100.0|46/46| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 14->40|PS00828|RIBOSOMAL_L36|PDOC00650| BL:PDB:NREP 1 BL:PDB:REP 17->41|3bbo6|1e-05|60.0|25/38| RP:PDB:NREP 1 RP:PDB:REP 1->41|3bbo6|2e-06|50.0|38/38| HM:PFM:NREP 1 HM:PFM:REP 1->41|PF00444|5.9e-22|63.2|38/38|Ribosomal_L36| HM:SCP:REP 1->41|2i2t41|9.2e-12|63.2|38/0|g.42.1.1|1/1|Ribosomal protein L36| OP:NHOMO 137 OP:NHOMOORG 137 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1------------------11111111111---------------------------1-11111111-11-------------1-----1-111----------------------1-----------------------------------------------1---------1----1111111-----------------------------------------------------------------111------1---------------------------------11-11111--1111-11-111111--1-1--11----1111111-1-111111111111111-------1-11-111111111------------------111-1-1----1------------1--1111-1--------------------11---111111---11111111-111111---------------------------------------------------------11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 38 STR:RPRED 82.6 SQ:SECSTR ccccccc###ccccTTcccEEETTEEEccccccGGGccccc##### DISOP:02AL 1-7,37-47| PSIPRED cHHHHHHHHHHcccccccEEEEccEEEEEEcccccEEEEccccccc //