[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : rpsB
DDBJ      :rpsB         ribosomal protein S2
Swiss-Prot:RS2_SALTY    RecName: Full=30S ribosomal protein S2;

Homologs  Archaea  0/68 : Bacteria  909/915 : Eukaryota  134/199 : Viruses  0/175   --->[See Alignment]
c.23.15
:241 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->241 2gy9B PDBj e-132 97.5 %
:RPS:PDB   6->225 2e5lB PDBj 1e-82 44.5 %
:RPS:SCOP  6->239 1fjgB  c.23.15.1 * 6e-97 42.3 %
:HMM:SCOP  6->242 1fjgB_ c.23.15.1 * 5.1e-97 58.2 %
:RPS:PFM   9->223 PF00318 * Ribosomal_S2 5e-76 63.0 %
:HMM:PFM   9->225 PF00318 * Ribosomal_S2 7.5e-89 52.6 211/211  
:BLT:SWISS 1->241 RS2_SALTY e-137 100.0 %
:PROS 6->17|PS00962|RIBOSOMAL_S2_1
:PROS 158->182|PS00963|RIBOSOMAL_S2_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69750.1 GT:GENE rpsB GT:PRODUCT ribosomal protein S2 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 262033..262758 GB:FROM 262033 GB:TO 262758 GB:DIRECTION + GB:GENE rpsB GB:PRODUCT ribosomal protein S2 GB:NOTE identified by match to protein family HMM PF00318; match to protein family HMM TIGR01011 GB:PROTEIN_ID ACF69750.1 GB:DB_XREF GI:194409531 GB:GENE:GENE rpsB LENGTH 241 SQ:AASEQ MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKISARKGKILFVGTKRAASEAVKEAANSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVAATVREGRSQDLASQAEESFVEAE GT:EXON 1|1-241:0| SW:ID RS2_SALTY SW:DE RecName: Full=30S ribosomal protein S2; SW:GN Name=rpsB; OrderedLocusNames=STM0216; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->241|RS2_SALTY|e-137|100.0|241/241| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 6->17|PS00962|RIBOSOMAL_S2_1|PDOC00744| PROS 158->182|PS00963|RIBOSOMAL_S2_2|PDOC00744| BL:PDB:NREP 1 BL:PDB:REP 6->241|2gy9B|e-132|97.5|236/236| RP:PDB:NREP 1 RP:PDB:REP 6->225|2e5lB|1e-82|44.5|220/222| RP:PFM:NREP 1 RP:PFM:REP 9->223|PF00318|5e-76|63.0|211/212|Ribosomal_S2| HM:PFM:NREP 1 HM:PFM:REP 9->225|PF00318|7.5e-89|52.6|211/211|Ribosomal_S2| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00318|IPR001865| GO:PFM GO:0005622|"GO:intracellular"|PF00318|IPR001865| GO:PFM GO:0005840|"GO:ribosome"|PF00318|IPR001865| GO:PFM GO:0006412|"GO:translation"|PF00318|IPR001865| RP:SCP:NREP 1 RP:SCP:REP 6->239|1fjgB|6e-97|42.3|234/237|c.23.15.1| HM:SCP:REP 6->242|1fjgB_|5.1e-97|58.2|237/0|c.23.15.1|1/1|Ribosomal protein S2| OP:NHOMO 1058 OP:NHOMOORG 1043 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------1-----11111111111111111111111111111111111111111111111-1111111111111111111111111111-11-1-1----1-11111-12-211112--11--1-11-2-341-1-21-1---111--------11-1-11121111-111--1112---------111-1-1------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 241 STR:RPRED 100.0 SQ:SECSTR ccHcccccccccccccccccccccGGGGGGEEEEETTEEEEcHHHHHHHHHHHHHHHHHHHHTTccEEEEcccTTTHHHHHHHHHHHTccEEcccccTTTTTcHHHHHHHHHHHHHHHHHTTccTTTcccHHHHHHHHHHHHHHHHHTTTGGGccccccEEEEccTTTTHHHHHHHHHTTccEEEcccTTccGGGcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccGGGc DISOP:02AL 1-1,225-235| PSIPRED cccccHHHHHHccccccccccccccccccEEEEEEccEEEEcHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHccccEEcccccccHHHcHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHccccEEEEEccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccc //