[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : rpsP
DDBJ      :rpsP         ribosomal protein S16
Swiss-Prot:RS16_SALTY   RecName: Full=30S ribosomal protein S16;

Homologs  Archaea  0/68 : Bacteria  787/915 : Eukaryota  93/199 : Viruses  0/175   --->[See Alignment]
d.27.1
:82 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->82 1vs5P PDBj 2e-42 97.6 %
:RPS:PDB   1->77 3bbnP PDBj 2e-26 37.0 %
:RPS:SCOP  1->82 1vs5P1  d.27.1.1 * 1e-30 97.6 %
:HMM:SCOP  1->84 1fjgP_ d.27.1.1 * 1.6e-26 48.2 %
:RPS:PFM   8->65 PF00886 * Ribosomal_S16 2e-13 56.9 %
:HMM:PFM   8->68 PF00886 * Ribosomal_S16 2.4e-28 49.2 61/62  
:BLT:SWISS 1->82 RS16_SALTY 3e-43 100.0 %
:PROS 2->11|PS00732|RIBOSOMAL_S16

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70245.1 GT:GENE rpsP GT:PRODUCT ribosomal protein S16 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2824837..2825085) GB:FROM 2824837 GB:TO 2825085 GB:DIRECTION - GB:GENE rpsP GB:PRODUCT ribosomal protein S16 GB:NOTE identified by match to protein family HMM PF00886; match to protein family HMM TIGR00002 GB:PROTEIN_ID ACF70245.1 GB:DB_XREF GI:194410026 GB:GENE:GENE rpsP LENGTH 82 SQ:AASEQ MVTIRLARHGAKKRPFYQVVVTDSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHWVGQGATISDRVAALIKEVKKAA GT:EXON 1|1-82:0| SW:ID RS16_SALTY SW:DE RecName: Full=30S ribosomal protein S16; SW:GN Name=rpsP; OrderedLocusNames=STM2676; SW:KW Complete proteome; Endonuclease; Hydrolase; Nuclease;Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->82|RS16_SALTY|3e-43|100.0|82/82| GO:SWS:NREP 5 GO:SWS GO:0004519|"GO:endonuclease activity"|Endonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 2->11|PS00732|RIBOSOMAL_S16|PDOC00600| BL:PDB:NREP 1 BL:PDB:REP 1->82|1vs5P|2e-42|97.6|82/82| RP:PDB:NREP 1 RP:PDB:REP 1->77|3bbnP|2e-26|37.0|73/80| RP:PFM:NREP 1 RP:PFM:REP 8->65|PF00886|2e-13|56.9|58/62|Ribosomal_S16| HM:PFM:NREP 1 HM:PFM:REP 8->68|PF00886|2.4e-28|49.2|61/62|Ribosomal_S16| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00886|IPR000307| GO:PFM GO:0005622|"GO:intracellular"|PF00886|IPR000307| GO:PFM GO:0005840|"GO:ribosome"|PF00886|IPR000307| GO:PFM GO:0006412|"GO:translation"|PF00886|IPR000307| RP:SCP:NREP 1 RP:SCP:REP 1->82|1vs5P1|1e-30|97.6|82/82|d.27.1.1| HM:SCP:REP 1->84|1fjgP_|1.6e-26|48.2|83/83|d.27.1.1|1/1|Ribosomal protein S16| OP:NHOMO 925 OP:NHOMOORG 880 OP:PATTERN -------------------------------------------------------------------- 1111---111111-------------------1-----111--111-1-111111-1111--111-111--1111---11111--1--111-1111-1-11111-1-1-11111111111----1111111111-111111111111-------------------1----------------1111111-111111111111111111111111111111111111111111-1111111111111-1111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111--111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111-1111111111111111111111111111-111-111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111-11----11111111111----1---1----111-1--11---11111111111-1 ------------111--111---1111---------------------111111---11----11-1---111-1-1-1-1111---1---------------112---1------1-1--11111-11351-121-----111111---111111--1----111--11---122--2M1112232221231111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 100.0 SQ:SECSTR cEEEcccccccTTccccccccEETTcccccccccccccccTTTccccccccccTTTccccTTcccEEcTTTccccTTTTccc DISOP:02AL 81-83| PSIPRED cEEEEEHHcccccccEEEEEEEEcccccccccEEEcccccccccccccEEEEcHHHHHHHHHccccccHHHHHHHHHHHHcc //