[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : rpsT
DDBJ      :rpsT         ribosomal protein S20
Swiss-Prot:RS20_SALTY   RecName: Full=30S ribosomal protein S20;

Homologs  Archaea  0/68 : Bacteria  514/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.7.6
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->87 1vs5T PDBj 6e-43 97.6 %
:RPS:PDB   6->79 3bbnT PDBj 8e-08 39.2 %
:RPS:SCOP  3->87 1vs5T1  a.7.6.1 * 2e-16 97.6 %
:HMM:SCOP  3->86 1fjgT_ a.7.6.1 * 8.4e-27 54.8 %
:RPS:PFM   2->84 PF01649 * Ribosomal_S20p 3e-05 63.9 %
:HMM:PFM   2->85 PF01649 * Ribosomal_S20p 7.8e-34 54.8 84/84  
:BLT:SWISS 1->87 RS20_SALTY 2e-44 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66648.1 GT:GENE rpsT GT:PRODUCT ribosomal protein S20 GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(47737..48000) GB:FROM 47737 GB:TO 48000 GB:DIRECTION - GB:GENE rpsT GB:PRODUCT ribosomal protein S20 GB:NOTE identified by match to protein family HMM PF01649; match to protein family HMM TIGR00029 GB:PROTEIN_ID ACF66648.1 GB:DB_XREF GI:194406429 GB:GENE:GENE rpsT LENGTH 87 SQ:AASEQ MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAALKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA GT:EXON 1|1-87:0| SW:ID RS20_SALTY SW:DE RecName: Full=30S ribosomal protein S20; SW:GN Name=rpsT; OrderedLocusNames=STM0043; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->87|RS20_SALTY|2e-44|100.0|87/87| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 3->87|1vs5T|6e-43|97.6|85/85| RP:PDB:NREP 1 RP:PDB:REP 6->79|3bbnT|8e-08|39.2|74/102| RP:PFM:NREP 1 RP:PFM:REP 2->84|PF01649|3e-05|63.9|83/84|Ribosomal_S20p| HM:PFM:NREP 1 HM:PFM:REP 2->85|PF01649|7.8e-34|54.8|84/84|Ribosomal_S20p| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF01649|IPR002583| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01649|IPR002583| GO:PFM GO:0005622|"GO:intracellular"|PF01649|IPR002583| GO:PFM GO:0005840|"GO:ribosome"|PF01649|IPR002583| GO:PFM GO:0006412|"GO:translation"|PF01649|IPR002583| RP:SCP:NREP 1 RP:SCP:REP 3->87|1vs5T1|2e-16|97.6|85/85|a.7.6.1| HM:SCP:REP 3->86|1fjgT_|8.4e-27|54.8|84/99|a.7.6.1|1/1|Ribosomal protein S20| OP:NHOMO 518 OP:NHOMOORG 517 OP:PATTERN -------------------------------------------------------------------- ----11111111-1-11----1111------11111-111---1-111-11-111111--1111111---1-------1------1---------------------1-1--------------------------111----------------------------------------------------1111111111111111111---11111111-111------1---------------------11----------------1-----11---11111--111111111111111111111111111---1111-----1111111-1--1--11--1-111----1---11-1-------111--1----111-1111111111111111111111111-11-11-1-1-1-1111---11111---11-11----1111111111111111-11--------11------------------------111111------11111----111111------------111111--111--11111111111111111111-1-1111----11--1111-11-1------11-----------------------11111111111111111111111111111111111-111111111111111-111111111-11-111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111---------1------1------1-------------------111-111--- ------------------------------------------------------------------------------------------------------------2--------------------------------------------------------1--------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 97.7 SQ:SECSTR ##ccccccHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHTTccccccccTTHHHHHHHHHHHHHHTTc DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHc //