[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : smpB
DDBJ      :smpB         SsrA-binding protein
Swiss-Prot:SSRP_SALTY   RecName: Full=SsrA-binding protein;

Homologs  Archaea  0/68 : Bacteria  892/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
b.111.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->138 1k8hA PDBj 2e-23 45.1 %
:RPS:PDB   12->133 2czjA PDBj 1e-46 44.6 %
:RPS:SCOP  10->134 1p6vA  b.111.1.1 * 1e-48 49.6 %
:HMM:SCOP  6->138 1k8hA_ b.111.1.1 * 6.2e-51 49.2 %
:RPS:PFM   13->80 PF01668 * SmpB 2e-22 66.2 %
:HMM:PFM   13->78 PF01668 * SmpB 9.3e-32 56.1 66/68  
:BLT:SWISS 1->160 SSRP_SALTY 2e-92 100.0 %
:PROS 32->44|PS01317|SSRP

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF66372.1 GT:GENE smpB GT:PRODUCT SsrA-binding protein GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2834681..2835163 GB:FROM 2834681 GB:TO 2835163 GB:DIRECTION + GB:GENE smpB GB:PRODUCT SsrA-binding protein GB:NOTE identified by match to protein family HMM PF01668; match to protein family HMM TIGR00086 GB:PROTEIN_ID ACF66372.1 GB:DB_XREF GI:194406153 GB:GENE:GENE smpB LENGTH 160 SQ:AASEQ MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANIGDSYVILKDGEAWLFGANFTPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDLKEREWQLDKARIMKNAGR GT:EXON 1|1-160:0| SW:ID SSRP_SALTY SW:DE RecName: Full=SsrA-binding protein; SW:GN Name=smpB; Synonyms=smqB; OrderedLocusNames=STM2688; SW:KW Complete proteome; Cytoplasm; RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->160|SSRP_SALTY|2e-92|100.0|160/160| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| PROS 32->44|PS01317|SSRP|PDOC01021| BL:PDB:NREP 1 BL:PDB:REP 14->138|1k8hA|2e-23|45.1|122/133| RP:PDB:NREP 1 RP:PDB:REP 12->133|2czjA|1e-46|44.6|121/122| RP:PFM:NREP 1 RP:PFM:REP 13->80|PF01668|2e-22|66.2|68/69|SmpB| HM:PFM:NREP 1 HM:PFM:REP 13->78|PF01668|9.3e-32|56.1|66/68|SmpB| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF01668|IPR000037| GO:PFM GO:0006412|"GO:translation"|PF01668|IPR000037| RP:SCP:NREP 1 RP:SCP:REP 10->134|1p6vA|1e-48|49.6|121/125|b.111.1.1| HM:SCP:REP 6->138|1k8hA_|6.2e-51|49.2|132/133|b.111.1.1|1/1|Small protein B (SmpB)| OP:NHOMO 904 OP:NHOMOORG 899 OP:PATTERN -------------------------------------------------------------------- 111111111111111-111-111111111111111111111111111111111-1111111111111111111111111111111111----1-------1-1111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-111111111111111-1111111111-11111 ------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------------11----------------111---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 79.4 SQ:SECSTR ###########cccEEcHHHHTTcccccEEEEEcccccHHHHHHHccccccTTcEEEEccccEEEEcccccTTccccccccccccccEEccccHHHHHHHHHTTTTTTcccEEEEEEETTccEEEEEEcccccccccc###################### DISOP:02AL 1-14,156-161| PSIPRED ccccccccccccEEEEEccEEccEEEEEEEEccEEEEHHHHHHHHHccccEEEEEEEEEccEEEEEcccccEEEccccEEcccccccHHHHHcHHHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccc //