[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : tal1
DDBJ      :tal1         transaldolase
Swiss-Prot:TALA_SALTI   RecName: Full=Transaldolase A;         EC=2.2.1.2;

Homologs  Archaea  10/68 : Bacteria  562/915 : Eukaryota  182/199 : Viruses  2/175   --->[See Alignment]
c.1.10
:316 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->312 1onrA PDBj e-110 61.1 %
:RPS:PDB   2->316 2e1dA PDBj 7e-69 57.8 %
:RPS:SCOP  2->316 1f05A  c.1.10.1 * 3e-44 57.5 %
:HMM:SCOP  2->317 2cwnA1 c.1.10.1 * 5.4e-122 46.5 %
:RPS:PFM   13->245 PF00923 * Transaldolase 7e-62 60.1 %
:HMM:PFM   13->310 PF00923 * Transaldolase 8.3e-106 46.6 279/287  
:BLT:SWISS 1->316 TALA_SALTI e-175 99.7 %
:PROS 128->145|PS00958|TRANSALDOLASE_2
:PROS 30->38|PS01054|TRANSALDOLASE_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF70195.1 GT:GENE tal1 GT:PRODUCT transaldolase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 2639053..2640003 GB:FROM 2639053 GB:TO 2640003 GB:DIRECTION + GB:GENE tal1 GB:PRODUCT transaldolase GB:NOTE identified by match to protein family HMM PF00923; match to protein family HMM TIGR00874 GB:PROTEIN_ID ACF70195.1 GB:DB_XREF GI:194409976 GB:GENE:GENE tal1 LENGTH 316 SQ:AASEQ MNQLDGIKQFTTVVADSGDIESIRHYQPQDATTNPSLLLKAAGLEQYGHLIEDAIAWGKKHGGTQEQQVAAASDKLAVNFGAEILKSIPGRVSTEVDARLSFDKEKSIEKARHLVDLYQQQDVDKSRILIKLAATWEGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVYLISPFVGRIYDWYQARSPLEPYVVEEDPGVKSVRNIYDYFKQHRYETIVMGASFRRTEQILALTGCDRLTISPNLLKELKEKEEPVIRKLVPSSQMFHRPTPMTEAEFRWEHNQDAMAVEKLSEGIRLFAIDQRKLEDLLAAKL GT:EXON 1|1-316:0| SW:ID TALA_SALTI SW:DE RecName: Full=Transaldolase A; EC=2.2.1.2; SW:GN Name=talA; OrderedLocusNames=STY2710, t0386; SW:KW Complete proteome; Cytoplasm; Pentose shunt; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->316|TALA_SALTI|e-175|99.7|316/316| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006098|"GO:pentose-phosphate shunt"|Pentose shunt| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 128->145|PS00958|TRANSALDOLASE_2|PDOC00741| PROS 30->38|PS01054|TRANSALDOLASE_1|PDOC00741| SEG 247->256|llkelkekee| BL:PDB:NREP 1 BL:PDB:REP 2->312|1onrA|e-110|61.1|311/316| RP:PDB:NREP 1 RP:PDB:REP 2->316|2e1dA|7e-69|57.8|315/321| RP:PFM:NREP 1 RP:PFM:REP 13->245|PF00923|7e-62|60.1|218/263|Transaldolase| HM:PFM:NREP 1 HM:PFM:REP 13->310|PF00923|8.3e-106|46.6|279/287|Transaldolase| GO:PFM:NREP 1 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00923|IPR001585| RP:SCP:NREP 1 RP:SCP:REP 2->316|1f05A|3e-44|57.5|315/322|c.1.10.1| HM:SCP:REP 2->317|2cwnA1|5.4e-122|46.5|316/0|c.1.10.1|1/1|Aldolase| OP:NHOMO 943 OP:NHOMOORG 756 OP:PATTERN -----------------------------1-----111111--------------------11----1 1-11----------11111-1---1111111111111-111----1------111--11111---1111-1----1-1-11--11111111--111-----11-----2-1111111111111111111111111111111---1-211-1111111111111111111111111111111112111--1-1--11111111-1111111-----111---1---11111-11-------------------------------11--1--1-------1211111--------------1111111111111---------2111-51111121111-1--111111-1-112--111---211-11111---1-1111-1--121----------1-------------------1----1111111111-----111-11111-11---------------111111111------------------------1--111111111111111111111111111111111111111111111211111-11111----------1---1-111-----1----11211111111111111-1-1-----------------111---1151121-112111111111111111111111-1---11111122211222222222222-22222222222222222233332211122222222222222222121222211111111111111111----------1122111111111111111211111111113111111112111111111111111111-111111111112111111111111-------1--11--------------------------------------1111111121-1- ----111-211-1111211211122231111111111111111111111423241221222211111111221212222211111111-11223322222112222-1312121111111111111121171-112-11111121111--1--1121143411111111121211-121E11122112111-23211-1 ------------------------1-------------------------1---------------------------------------------------------------------------------------------------------------------------- STR:NPRED 316 STR:RPRED 100.0 SQ:SECSTR ccHHHHHTTTcEEEEEcccGGGTTTTcccEEEccHHHHHHHHTcGGGHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccGGGTTcHHHHHHHHHHHHHHHHHTTccGGGEEEEEEccHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHTccEEEEccHHHHHHHHHHcccccccGGGcHHHHHHHHHHHHHHHTTcccEEEEcccccHHHHHTTTTccEEEEcHHHHHHHHHccccccccccHHTTcccccccccHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHH PSIPRED ccHHHHHHHHcEEEEEcccHHHHHHccccEEEccHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHccccccEEEEEccHHHccHHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHcccEEEEEHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHcccEEEccHHHHHHHHHcccccccccccHHHcccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //