[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : tehB
DDBJ      :tehB         tellurite resistance protein TehB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  152/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:198 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->192 2i6gB PDBj 9e-87 98.3 %
:RPS:PDB   5->173 3cggB PDBj 1e-14 17.7 %
:RPS:SCOP  2->198 2i6gA1  c.66.1.44 * 2e-75 90.3 %
:HMM:SCOP  1->196 2i6gA1 c.66.1.44 * 6.8e-35 27.0 %
:RPS:PFM   23->161 PF03848 * TehB 4e-53 70.9 %
:HMM:PFM   1->193 PF03848 * TehB 9.6e-99 64.6 192/192  
:BLT:SWISS 1->196 TEHB_ECOLI 7e-98 84.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69428.1 GT:GENE tehB GT:PRODUCT tellurite resistance protein TehB GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1746447..1747043) GB:FROM 1746447 GB:TO 1747043 GB:DIRECTION - GB:GENE tehB GB:PRODUCT tellurite resistance protein TehB GB:NOTE identified by match to protein family HMM PF03848; match to protein family HMM PF08241; match to protein family HMM PF08242; match to protein family HMM TIGR00477 GB:PROTEIN_ID ACF69428.1 GB:DB_XREF GI:194409209 GB:GENE:GENE tehB LENGTH 198 SQ:AASEQ MTVRDENYFTEKYGLTRTHSDVLAAAKVVAPGRTLDLGCGNGRNSLYLAANGYDVTAWDKNPASMANLERIKAAEGLDNLQTDIVDLNTLTFDGEYDFILSTVVMMFLEAQTIPGLIANMQRCTKPGGYNLIVAAMDTPDFPCTVGFPFAFKEGELRRYYEGWDMLKYNEDVGELHRTDENGNRIKLRFATMLARKTA GT:EXON 1|1-198:0| BL:SWS:NREP 1 BL:SWS:REP 1->196|TEHB_ECOLI|7e-98|84.2|196/197| BL:PDB:NREP 1 BL:PDB:REP 2->192|2i6gB|9e-87|98.3|177/182| RP:PDB:NREP 1 RP:PDB:REP 5->173|3cggB|1e-14|17.7|164/182| RP:PFM:NREP 1 RP:PFM:REP 23->161|PF03848|4e-53|70.9|134/156|TehB| HM:PFM:NREP 1 HM:PFM:REP 1->193|PF03848|9.6e-99|64.6|192/192|TehB| RP:SCP:NREP 1 RP:SCP:REP 2->198|2i6gA1|2e-75|90.3|176/177|c.66.1.44| HM:SCP:REP 1->196|2i6gA1|6.8e-35|27.0|196/0|c.66.1.44|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 154 OP:NHOMOORG 153 OP:PATTERN -------------------------------------------------------------------- --2-----------1--11-1-----11111--------------------------------------------------------------------------1---------------------------------1--------------------------------------------------------------------------------------------1----------------------------------------------111----11111111111111-------------111111111----------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----------------------------1---1-1111-11---------------------1-1-1111---------------------------------1--------1------------------------------------11-1-111111111111-11111111-111111111111111111111111111111111111111111--111111-11111---------1111-----111111-111-1--1----------------------------------------------------------------------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 100.0 SQ:SECSTR EEccHHHHHHHHHTTccccHHHHHHHHHcTTcEEEEETcTTcHHHHHHHHTTcEEEEEEccHHHHHHHHHHcTTcEEEEccTTTcccTccGccccEEEEEEcccHHHccGGGHHHHHHHHHHHEEEEEEEEEEEEETTccccHHHHHHHHHHHTEEEEEEccTTcccccTTccEEEEHHEETTTEEEEEEEEEEEEHH DISOP:02AL 198-199| PSIPRED ccccHHHHcccHHcccccHHHHHHHcccccccEEEEEcccccHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccccEEEEccHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccHHcccHHHHHHHccccHHHHHHHHcccccccccccEEEEEEEEEEEEEcc //