[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : trmD
DDBJ      :trmD         tRNA (guanine-N1)-methyltransferase
Swiss-Prot:TRMD_SALSV   RecName: Full=tRNA (guanine-N(1)-)-methyltransferase;         EC=2.1.1.31;AltName: Full=M1G-methyltransferase;AltName: Full=tRNA [GM37] methyltransferase;

Homologs  Archaea  0/68 : Bacteria  904/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.116.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->246 1p9pA PDBj e-124 97.0 %
:RPS:PDB   163->247 2btlA PDBj 9e-32 15.3 %
:RPS:SCOP  1->233 1oy5A  c.116.1.4 * 3e-72 38.6 %
:HMM:SCOP  1->250 1ualA_ c.116.1.4 * 5.1e-103 53.6 %
:RPS:PFM   23->221 PF01746 * tRNA_m1G_MT 5e-64 60.9 %
:HMM:PFM   23->221 PF01746 * tRNA_m1G_MT 1.6e-63 44.3 185/186  
:BLT:SWISS 1->255 TRMD_SALSV e-141 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF65926.1 GT:GENE trmD GT:PRODUCT tRNA (guanine-N1)-methyltransferase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2823458..2824225) GB:FROM 2823458 GB:TO 2824225 GB:DIRECTION - GB:GENE trmD GB:PRODUCT tRNA (guanine-N1)-methyltransferase GB:NOTE identified by match to protein family HMM PF01746; match to protein family HMM TIGR00088 GB:PROTEIN_ID ACF65926.1 GB:DB_XREF GI:194405707 GB:GENE:GENE trmD LENGTH 255 SQ:AASEQ MFIGIVSLFPEMFRAITDYGVTGRAVKKGLLNIQSWSPRDFTHDRHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGVDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVARFIPGVLGHEASAIEDSFADGLLDCPHYTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQARLLAEFKTEHAQQQHKHDGMA GT:EXON 1|1-255:0| SW:ID TRMD_SALSV SW:DE RecName: Full=tRNA (guanine-N(1)-)-methyltransferase; EC=2.1.1.31;AltName: Full=M1G-methyltransferase;AltName: Full=tRNA [GM37] methyltransferase; SW:GN Name=trmD; OrderedLocusNames=SeSA_A2869; SW:KW Complete proteome; Cytoplasm; Methyltransferase;S-adenosyl-L-methionine; Transferase; tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->255|TRMD_SALSV|e-141|100.0|255/255| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| SEG 73->83|aakaaagegak| BL:PDB:NREP 1 BL:PDB:REP 1->246|1p9pA|e-124|97.0|235/235| RP:PDB:NREP 1 RP:PDB:REP 163->247|2btlA|9e-32|15.3|85/134| RP:PFM:NREP 1 RP:PFM:REP 23->221|PF01746|5e-64|60.9|192/193|tRNA_m1G_MT| HM:PFM:NREP 1 HM:PFM:REP 23->221|PF01746|1.6e-63|44.3|185/186|tRNA_m1G_MT| RP:SCP:NREP 1 RP:SCP:REP 1->233|1oy5A|3e-72|38.6|215/218|c.116.1.4| HM:SCP:REP 1->250|1ualA_|5.1e-103|53.6|250/252|c.116.1.4|1/1|alpha/beta knot| OP:NHOMO 908 OP:NHOMOORG 904 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111121111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111211-1111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111-1111111111111111111111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 97.6 SQ:SECSTR cEEEEEcccGGGGHHHHccHHHHHHHHTTccEEEEEcGGGGcccTTcccEEccTTcccccccccTTTcccccccccccccccEEEcccccccGGGEEEHHEEEEEEEEEEcccccccEEEEHEEEEEcTTcccEEEEEEEEEccccccccccccccEEEEEEccccccccccccEEEccTTcccccEEcccccccccccGGGcEEEEEEEEEEEEccccEEEEEEEEEEEETTccTTTTccTTcccTcc###### DISOP:02AL 240-256| PSIPRED cEEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEEHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHccccEEEEEccHHHHHHHHHHHHccEEEEcccEEEcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccHHccccccHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccc //