[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : trmU
DDBJ      :trmU         tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Swiss-Prot:MNMA_SALTI   RecName: Full=tRNA-specific 2-thiouridylase mnmA;         EC=2.8.1.-;

Homologs  Archaea  0/68 : Bacteria  897/915 : Eukaryota  128/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:368 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->368 2deuA PDBj 0.0 95.7 %
:RPS:PDB   4->368 2detA PDBj e-121 88.8 %
:RPS:SCOP  22->283 1xngA1  c.26.2.1 * 2e-30 18.3 %
:HMM:SCOP  4->244 2c5sA1 c.26.2.6 * 5.9e-61 41.9 %
:RPS:PFM   22->360 PF03054 * tRNA_Me_trans e-125 64.7 %
:HMM:PFM   6->360 PF03054 * tRNA_Me_trans 2.1e-151 55.6 351/356  
:BLT:SWISS 1->368 MNMA_SALTI 0.0 100.0 %
:PROS 347->358|PS00070|ALDEHYDE_DEHYDR_CYS
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68451.1 GT:GENE trmU GT:PRODUCT tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1325929..1327035) GB:FROM 1325929 GB:TO 1327035 GB:DIRECTION - GB:GENE trmU GB:PRODUCT tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase GB:NOTE identified by match to protein family HMM PF03054; match to protein family HMM TIGR00420 GB:PROTEIN_ID ACF68451.1 GB:DB_XREF GI:194408232 GB:GENE:GENE trmU LENGTH 368 SQ:AASEQ MSESPKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSRLLRGLDGNKDQSYFLYTLGHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFRDFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKDGSEDPWYVVDKDVENNVLIVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTLRCTVKTRYRQTDIPCTINALDDDRIEVIFDEPVAAVTPGQSAVFYSGEVCLGGGIIEQRLPLTV GT:EXON 1|1-368:0| SW:ID MNMA_SALTI SW:DE RecName: Full=tRNA-specific 2-thiouridylase mnmA; EC=2.8.1.-; SW:GN Name=mnmA; Synonyms=trmU; OrderedLocusNames=STY1274, t1686; SW:KW ATP-binding; Complete proteome; Cytoplasm; Disulfide bond;Nucleotide-binding; RNA-binding; Transferase; tRNA processing;tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->368|MNMA_SALTI|0.0|100.0|368/368| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 347->358|PS00070|ALDEHYDE_DEHYDR_CYS|PDOC00068| SEG 8->21|vivgmsggvdssvs| SEG 51->60|aaadladaqa| BL:PDB:NREP 1 BL:PDB:REP 22->368|2deuA|0.0|95.7|347/364| RP:PDB:NREP 1 RP:PDB:REP 4->368|2detA|e-121|88.8|365/365| RP:PFM:NREP 1 RP:PFM:REP 22->360|PF03054|e-125|64.7|331/348|tRNA_Me_trans| HM:PFM:NREP 1 HM:PFM:REP 6->360|PF03054|2.1e-151|55.6|351/356|tRNA_Me_trans| RP:SCP:NREP 1 RP:SCP:REP 22->283|1xngA1|2e-30|18.3|208/255|c.26.2.1| HM:SCP:REP 4->244|2c5sA1|5.9e-61|41.9|210/0|c.26.2.6|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 1141 OP:NHOMOORG 1025 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111-------111111111133331111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111121111111111111111111111111111111---1111111111111111111111111111111111111111111111111111222222212111111111121111111111111111112221122121111111111111111111111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111212111111111111212111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111121111111111111111111111111111111111111111111111111111111111211111111111111111111111-111111-11111111111111111111111111111111 ----111-311---1-----------------------------------------------11111111111111111111111111-111-11111111-1111-22122111121111-1112-318B1-312111-311111111-11-2122121--1211-114A11-32112I222223121-11222121- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 365 STR:RPRED 99.2 SQ:SECSTR ###cccEEEEEccccHHHHHHHHHHHHHccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHTcccccccTHHHHHHHTHHHHHHHHHTTccccTHHHHHHHTTTTHHHHHHHTTccccEEEcccccEEEEETTEEEEEccccGGGccGGGGGcccTHHHHHEEccGGGccHHHHHHHHHHHTcTTcccccccccTTcccccHHHHHTTTccccccccccTTccccccccccTTccTTcccccccccccccccccEEEEEccTTTTccEEEEcTTcGGGEEEEEEEEccccTTccccccEEEEEEEccTTcccEEEEEEccccccEEEEEEEEEETccTTcEEEEEETTEEEEEEEEEEEEEccc DISOP:02AL 1-4,368-369| PSIPRED ccccccEEEEEEcccHHHHHHHHHHHHccccEEEEEEEccccccccccccHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEEccccccEEEEEccccHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccccEEEcccccEEEEEccEEEEEcccccccccccccccccccEEEEEEEccccEEEEEEccccHHHHccEEEEEEEEEcccccccccEEEEEEEEEcccccEEEEEEEcccEEEEEEccccccccccEEEEEEcccEEEEEEEEEEcccccc //