[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : trpA
DDBJ      :trpA         tryptophan synthase, alpha subunit
Swiss-Prot:TRPA_SALTI   RecName: Full=Tryptophan synthase alpha chain;         EC=4.2.1.20;

Homologs  Archaea  35/68 : Bacteria  734/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->268 1k3uA PDBj e-138 99.6 %
:RPS:PDB   2->267 3cepA PDBj 2e-41 91.4 %
:RPS:SCOP  2->267 1a50A  c.1.2.4 * 3e-36 91.5 %
:HMM:SCOP  1->267 1xcfA_ c.1.2.4 * 1e-92 44.2 %
:RPS:PFM   8->261 PF00290 * Trp_syntA 4e-55 47.0 %
:HMM:PFM   8->266 PF00290 * Trp_syntA 1.8e-101 44.6 258/259  
:BLT:SWISS 1->268 TRPA_SALTI e-138 100.0 %
:PROS 48->61|PS00167|TRP_SYNTHASE_ALPHA
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF69359.1 GT:GENE trpA GT:PRODUCT tryptophan synthase, alpha subunit GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION 1872083..1872889 GB:FROM 1872083 GB:TO 1872889 GB:DIRECTION + GB:GENE trpA GB:PRODUCT tryptophan synthase, alpha subunit GB:NOTE identified by match to protein family HMM PF00290; match to protein family HMM TIGR00262 GB:PROTEIN_ID ACF69359.1 GB:DB_XREF GI:194409140 GB:GENE:GENE trpA LENGTH 268 SQ:AASEQ MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPEQMLAELRSFVSAMKAASRA GT:EXON 1|1-268:0| SW:ID TRPA_SALTI SW:DE RecName: Full=Tryptophan synthase alpha chain; EC=4.2.1.20; SW:GN Name=trpA; OrderedLocusNames=STY1324, t1639; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; Lyase; Tryptophan biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->268|TRPA_SALTI|e-138|100.0|268/268| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0000162|"GO:tryptophan biosynthetic process"|Tryptophan biosynthesis| PROS 48->61|PS00167|TRP_SYNTHASE_ALPHA|PDOC00151| SEG 220->240|vsaavragaagaisgsaivki| BL:PDB:NREP 1 BL:PDB:REP 1->268|1k3uA|e-138|99.6|268/268| RP:PDB:NREP 1 RP:PDB:REP 2->267|3cepA|2e-41|91.4|266/266| RP:PFM:NREP 1 RP:PFM:REP 8->261|PF00290|4e-55|47.0|253/255|Trp_syntA| HM:PFM:NREP 1 HM:PFM:REP 8->266|PF00290|1.8e-101|44.6|258/259|Trp_syntA| GO:PFM:NREP 2 GO:PFM GO:0004834|"GO:tryptophan synthase activity"|PF00290|IPR002028| GO:PFM GO:0006568|"GO:tryptophan metabolic process"|PF00290|IPR002028| RP:SCP:NREP 1 RP:SCP:REP 2->267|1a50A|3e-36|91.5|260/260|c.1.2.4| HM:SCP:REP 1->267|1xcfA_|1e-92|44.2|267/0|c.1.2.4|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 930 OP:NHOMOORG 886 OP:PATTERN -----------------------11-111111111111111111111111111111--1-------11 1111111111111111111-111111111111111111111211111-1111111111--111-11111111111111----111111111111---111-111111111-1111-1-11-----11111111111111111111111211112111111111111112211111111111111111111-11111111111-111111111111111111111111111111-1111111111111111111----11-----11--11----1-111-------21111111111111-------------1--111----11-11----------1-11----1-1--11111111111--1111111-11111111-----111111111111111111111111-11111111111-1111111111111111111111111111111111111111111-----------------------------111111111111111111111111111111-1111111111111111111111111111111111111111111111-1111111111--11111111111111111111111111111-1111111111111111111111111111111111111111111111---111111-11111111111111111111-1111111111111112111111111111111111111111111111111111-11111111111111-1111-1111111212111111-11111-111111111111111111111111111111111111111111111111111111111111111111111111-111111--------------------------------------1--1-111111 ------1-----11111111122343311-11111112111111-11111111111111211111111-1111111111111111111-11111111111-21112-11-------------------------------------------------1--------------1-11118111111442122112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHTTccEEEEEEETTcccHHHHHHHHHHHHHTTcccEEEEccccccTTccHHHHHHHHHHHHTTccHHHHHHHHHHHHHHcccccEEEEEcHHHHHTTcHHHHHHHHHHHTccEEEETTccGGGcHHHHHHHHHTTcEEEcEEcTTccHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHTTcccEEEEcccccHHHHHHHHHTTccEEEEcHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHTTcc DISOP:02AL 1-1,266-269| PSIPRED ccHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc //