[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : truA
DDBJ      :truA         tRNA pseudouridine synthase A
Swiss-Prot:TRUA_SALTI   RecName: Full=tRNA pseudouridine synthase A;         EC=5.4.99.12;AltName: Full=tRNA-uridine isomerase I;AltName: Full=tRNA pseudouridylate synthase I;

Homologs  Archaea  33/68 : Bacteria  885/915 : Eukaryota  86/199 : Viruses  0/175   --->[See Alignment]
d.265.1
:270 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->270 2nqpD PDBj e-140 95.4 %
:RPS:PDB   8->270 1dj0A PDBj 2e-80 89.4 %
:RPS:SCOP  8->270 1dj0A  d.265.1.1 * 1e-80 89.4 %
:HMM:SCOP  7->270 1dj0A_ d.265.1.1 * 2.7e-91 44.7 %
:RPS:PFM   14->73 PF01416 * PseudoU_synth_1 5e-09 50.0 %
:RPS:PFM   176->217 PF01416 * PseudoU_synth_1 3e-05 38.6 %
:HMM:PFM   16->112 PF01416 * PseudoU_synth_1 8.3e-16 35.4 79/105  
:HMM:PFM   152->253 PF01416 * PseudoU_synth_1 3.3e-20 29.7 101/105  
:BLT:SWISS 1->270 TRUA_SALTI e-145 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68757.1 GT:GENE truA GT:PRODUCT tRNA pseudouridine synthase A GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(2525232..2526044) GB:FROM 2525232 GB:TO 2526044 GB:DIRECTION - GB:GENE truA GB:PRODUCT tRNA pseudouridine synthase A GB:NOTE identified by match to protein family HMM PF01416; match to protein family HMM TIGR00071 GB:PROTEIN_ID ACF68757.1 GB:DB_XREF GI:194408538 GB:GENE:GENE truA LENGTH 270 SQ:AASEQ MSGQQSSPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPINVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLAKGVTHYYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLLEVGAHNQPESWIAELLAARDRTLAAATAKAEGLYLVAVDYPDRFDLPKPPMGPLFLAD GT:EXON 1|1-270:0| SW:ID TRUA_SALTI SW:DE RecName: Full=tRNA pseudouridine synthase A; EC=5.4.99.12;AltName: Full=tRNA-uridine isomerase I;AltName: Full=tRNA pseudouridylate synthase I; SW:GN Name=truA; OrderedLocusNames=STY2599, t0496; SW:KW Complete proteome; Isomerase; tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->270|TRUA_SALTI|e-145|100.0|270/270| GO:SWS:NREP 2 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| SEG 225->247|aellaardrtlaaatakaeglyl| BL:PDB:NREP 1 BL:PDB:REP 8->270|2nqpD|e-140|95.4|263/263| RP:PDB:NREP 1 RP:PDB:REP 8->270|1dj0A|2e-80|89.4|263/264| RP:PFM:NREP 2 RP:PFM:REP 14->73|PF01416|5e-09|50.0|60/112|PseudoU_synth_1| RP:PFM:REP 176->217|PF01416|3e-05|38.6|42/112|PseudoU_synth_1| HM:PFM:NREP 2 HM:PFM:REP 16->112|PF01416|8.3e-16|35.4|79/105|PseudoU_synth_1| HM:PFM:REP 152->253|PF01416|3.3e-20|29.7|101/105|PseudoU_synth_1| GO:PFM:NREP 8 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF01416|IPR020097| GO:PFM GO:0003723|"GO:RNA binding"|PF01416|IPR020097| GO:PFM GO:0009451|"GO:RNA modification"|PF01416|IPR020097| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF01416|IPR020097| GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF01416|IPR020097| GO:PFM GO:0003723|"GO:RNA binding"|PF01416|IPR020097| GO:PFM GO:0009451|"GO:RNA modification"|PF01416|IPR020097| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF01416|IPR020097| RP:SCP:NREP 1 RP:SCP:REP 8->270|1dj0A|1e-80|89.4|263/264|d.265.1.1| HM:SCP:REP 7->270|1dj0A_|2.7e-91|44.7|264/264|d.265.1.1|1/1|Pseudouridine synthase| OP:NHOMO 1124 OP:NHOMOORG 1004 OP:PATTERN ------------------11---111111111111-1-----111-111111111111111------- 111-111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111-111-11112211112-1111111-11111211111111111111111111111111111111111111111111111111111111111111111-111-2222222222222211111122211111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111321122222221211211222232111-321111111121111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111112111111111111111111122122121111111111111111111111111111111111111111111111111111-111111--111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111-111111111111111111111111111111111111111111111111111111-1111111111111111---1--11----111--1111111111111111 ---111--1-1-11-------------------------------------------------11----1--111------1111111-1----21-------21212212-3112-11---2-3212-574-212---111112-----1---11311---11---1-------1223A333122125-431121223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 97.4 SQ:SECSTR #######ccEEEEEEEEEccTTccccccTTccccHHHHHHHHHHHHHTccccEEEcccccTTcEEEEEEEEEEEcccccHHHHHHHHHHTccTTEEEEEEEEccTTccTTTTccEEEEEEEEEcccccccTTTTccEEccccccHHHHHHHHGGGcEEEEcGGGccTTccccccEEEEEEEEEEEETTEEEEEEEEccccTTHHHHHHHHHHHHHTTcccTTHHHHHHHHccGGGcccccccTTEEEEEEEccGGGcccccccccTTccc DISOP:02AL 1-8| PSIPRED ccccccccccEEEEEEEEccccccccEEccccccHHHHHHHHHHHHccccEEEEEEEccccccccccEEEEEEEcccccHHHHHHHHHHHccccEEEEEEEEccccccccccccEEEEEEEEEcccccccHHcccEEEccccccHHHHHHHHHHHcccccHHHHHcccccccccEEEEEEEEEEEEccEEEEEEEEcHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccEEEEEcccccccccccccccccccc //