[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 (sent8)
Gene : trxB
DDBJ      :trxB         thioredoxin-disulfide reductase
Swiss-Prot:TRXB_ECOLI   RecName: Full=Thioredoxin reductase;         Short=TRXR;         EC=1.8.1.9;

Homologs  Archaea  68/68 : Bacteria  898/915 : Eukaryota  123/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:322 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->320 1f6mA PDBj e-171 96.2 %
:RPS:PDB   8->314 2a87B PDBj 2e-55 46.2 %
:RPS:SCOP  62->138 1ng3A1  c.3.1.2 * 1e-06 9.1 %
:RPS:SCOP  120->245 1cl0A2  c.3.1.5 * 2e-24 96.8 %
:HMM:SCOP  1->316 1f8rA1 c.3.1.2 * 3.1e-56 28.4 %
:RPS:PFM   9->288 PF07992 * Pyr_redox_2 8e-14 34.7 %
:HMM:PFM   8->290 PF07992 * Pyr_redox_2 1.3e-45 33.8 195/202  
:BLT:SWISS 1->320 TRXB_ECOLI e-173 96.6 %
:PROS 136->156|PS00573|PYRIDINE_REDOX_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF68147.1 GT:GENE trxB GT:PRODUCT thioredoxin-disulfide reductase GT:DATABASE GIB00763CH01 GT:ORG sent8 GB:ACCESSION GIB00763CH01 GB:LOCATION complement(1039592..1040560) GB:FROM 1039592 GB:TO 1040560 GB:DIRECTION - GB:GENE trxB GB:PRODUCT thioredoxin-disulfide reductase GB:NOTE identified by match to protein family HMM PF00070; match to protein family HMM PF07992; match to protein family HMM TIGR01292 GB:PROTEIN_ID ACF68147.1 GB:DB_XREF GI:194407928 GB:GENE:GENE trxB LENGTH 322 SQ:AASEQ MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHAAKFETEIIFDHINNVDLQNRPFRLTGDSAEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGLRLRDTQQSDNIETLDIAGLFVAIGHSPNTALFEGQLELENGYIKVQSGTHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADASK GT:EXON 1|1-322:0| SW:ID TRXB_ECOLI SW:DE RecName: Full=Thioredoxin reductase; Short=TRXR; EC=1.8.1.9; SW:GN Name=trxB; OrderedLocusNames=b0888, JW0871; SW:KW 3D-structure; Complete proteome; Cytoplasm; Direct protein sequencing;Disulfide bond; FAD; Flavoprotein; NADP; Oxidoreductase;Redox-active center. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->320|TRXB_ECOLI|e-173|96.6|320/321| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 136->156|PS00573|PYRIDINE_REDOX_2|PDOC00496| SEG 17->28|agytaavyaara| BL:PDB:NREP 1 BL:PDB:REP 2->320|1f6mA|e-171|96.2|319/320| RP:PDB:NREP 1 RP:PDB:REP 8->314|2a87B|2e-55|46.2|299/304| RP:PFM:NREP 1 RP:PFM:REP 9->288|PF07992|8e-14|34.7|248/275|Pyr_redox_2| HM:PFM:NREP 1 HM:PFM:REP 8->290|PF07992|1.3e-45|33.8|195/202|Pyr_redox_2| RP:SCP:NREP 2 RP:SCP:REP 62->138|1ng3A1|1e-06|9.1|77/276|c.3.1.2| RP:SCP:REP 120->245|1cl0A2|2e-24|96.8|126/126|c.3.1.5| HM:SCP:REP 1->316|1f8rA1|3.1e-56|28.4|306/371|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 2064 OP:NHOMOORG 1089 OP:PATTERN 11121134333333331122111117312312111111111111111211111111111112121111 2231311111121211112-12111211111122222353241231121111432121--1122122231112222222213113---222212221-1222243313121111111111111111112121122311112111113-111111111122211--1212212122222122221212211133444444444444444433442444333343333334444524444434334443333332343122122222233222214313433333243333233323332232333333333333222333222411235333333333323222332223314123244232312312221221212522311111233332223323311111111111122122111132121112121211212111221111111122222222122212232211111111222222222222222111223312112211244242211112279222212335436422333232322221322221222111111111111122211113352354431111111121114112141111111111111111111111111112222223122233333333333333333331-2111111111123222212222222222-223222222222222222333322122222211211122222212222222111111111111111113111112222121122222221222122214333423332223333232232222422211111111112223222223333333334332232222111122111111111111114----1-11111111111111111111211111111111 ----111----122322111111111111111111111111111111111111111111111111111-1221212212211111122-21121111111112221123------------------------------------------------------1------1--121351-111324343132111---3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 321 STR:RPRED 99.7 SQ:SECSTR EcccccEcEEEEccHHHHHHHHHHHHHTTcccEEEcccccccGGGccccccccTTcTTcccHHHHHHHHHHHHHHTTcEEEcccEEEEEcccccEEEETTccEEEEcEEEEcccEEEcccccTHHHHTcTTTEEccHHHHGGGGTTcEEEEEcccHHHHHHHHHHTTTccEEEEEcccccccccTTHHHHHHHHHHcTTEEEEccEEEEEEEccccEccEEEEEEETTccccEEEccccEEEcccEEEccTTTTTTccccTTccccccTTccTccccccTTEEEcGGGTccccccHHHHHHHHHHHHHHHHHHHHHHHHHE# DISOP:02AL 1-3,318-323| PSIPRED ccccEEEEEEEEcccHHHHHHHHHHHHccccEEEEEccccccEEEEEEEccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEcccEEEEEEcccEEEccEEEEEcccccccccccccHHcccccEEHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHccEEEEEEccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEEEEccccccEEEEEccEEEEEEEEEcccHHHHccccccccEEEEcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccccc //