[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54764.1
DDBJ      :             Tn5253 conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:150 amino acids
:SECSTR
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54764.1 GT:GENE ACF54764.1 GT:PRODUCT Tn5253 conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1252941..1253393) GB:FROM 1252941 GB:TO 1253393 GB:DIRECTION - GB:PRODUCT Tn5253 conserved hypothetical protein GB:PROTEIN_ID ACF54764.1 GB:DB_XREF GI:194356316 LENGTH 150 SQ:AASEQ MVDKREKLMNSFNQYGFLTFKQVIDENLHYKTLLKMLAEGKIDAEEKGLYRLPDIYLDEWFVLQYRFPKGIFSLETALWLHGLSLTIPFNMTMSFPYGTNTKNIKEADICPIILRSHYSEGIIEIERLPGQFIKVYEVERVLVECLCPAI GT:EXON 1|1-150:0| OP:NHOMO 18 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------1--11------111-1--1----------------11-1---------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------1--------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 77.3 SQ:SECSTR #####################cHHHHHHHHHHHHHHcccccEEEEEEEEEEEETTEEEEEEEEEEEETTEEEEEEEEcEEEEEEEEE#########EEcccEEEETTcccccEEEcccccccccccEEccccccHHHHHHHHHHHT#### DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHccccEEHHHHHHccccHHHHHHHHHcccEEEEcccEEEEEccccccEEEEEEEcccccHHHHHHHHHccHHHccccEEEEEEEEcccccccccccEEEEEEcccEEEccEEEEEEccEEEEEccHHHHHHHHccccc //