[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54768.1
DDBJ      :             aspartate kinase
Swiss-Prot:             

Homologs  Archaea  58/68 : Bacteria  845/915 : Eukaryota  116/199 : Viruses  0/175   --->[See Alignment]
c.73.1d.58.18
:454 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->448 2cdqA PDBj 3e-45 29.2 %
:RPS:PDB   3->450 3c1mA PDBj 5e-73 25.9 %
:RPS:SCOP  3->288 2cdqA1  c.73.1.3 * 1e-72 30.0 %
:RPS:SCOP  370->454 2hmfA3  d.58.18.10 * 4e-18 29.4 %
:HMM:SCOP  1->288 2hmfA1 c.73.1.3 * 2.5e-65 37.0 %
:HMM:SCOP  295->358 2cdqA2 d.58.18.10 * 3.7e-08 21.9 %
:HMM:SCOP  370->450 2hmfA3 d.58.18.10 * 1.5e-21 39.5 %
:RPS:PFM   3->276 PF00696 * AA_kinase 3e-23 37.7 %
:HMM:PFM   2->276 PF00696 * AA_kinase 3.4e-47 30.4 230/243  
:HMM:PFM   394->445 PF01842 * ACT 1e-11 32.7 52/66  
:BLT:SWISS 1->448 AK3_BACSU e-137 52.5 %
:PROS 3->11|PS00324|ASPARTOKINASE

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54768.1 GT:GENE ACF54768.1 GT:PRODUCT aspartate kinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(372467..373831) GB:FROM 372467 GB:TO 373831 GB:DIRECTION - GB:PRODUCT aspartate kinase GB:NOTE identified by match to protein family HMM PF00696; match to protein family HMM PF01842; match to protein family HMM TIGR00657 GB:PROTEIN_ID ACF54768.1 GB:DB_XREF GI:194356320 LENGTH 454 SQ:AASEQ MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAEDTKVTDALIKYYRDYVAGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISXSIHALATLPIEENEFLYDTFLAAGENNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSSYDKIEELTNTNEVLVIPGFFGVTKENQICTFSRGGSDITGSIIAAGVKXDLYENFTDVDGIFAAHPGIIHQPHSIPELTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPDHPGTRIVLKHSNDEFPVVGIAGDSGFVSINMSKYLMNREVGFGRKVLQILEELNIGWEHMPTGIDDLSIILRSRQLTPIKEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIGVTATATRALSENKINIQMMSQGSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED GT:EXON 1|1-454:0| BL:SWS:NREP 1 BL:SWS:REP 1->448|AK3_BACSU|e-137|52.5|448/454| PROS 3->11|PS00324|ASPARTOKINASE|PDOC00289| BL:PDB:NREP 1 BL:PDB:REP 3->448|2cdqA|3e-45|29.2|438/470| RP:PDB:NREP 1 RP:PDB:REP 3->450|3c1mA|5e-73|25.9|448/465| RP:PFM:NREP 1 RP:PFM:REP 3->276|PF00696|3e-23|37.7|239/244|AA_kinase| HM:PFM:NREP 2 HM:PFM:REP 2->276|PF00696|3.4e-47|30.4|230/243|AA_kinase| HM:PFM:REP 394->445|PF01842|1e-11|32.7|52/66|ACT| GO:PFM:NREP 1 GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF00696|IPR001048| RP:SCP:NREP 2 RP:SCP:REP 3->288|2cdqA1|1e-72|30.0|283/304|c.73.1.3| RP:SCP:REP 370->454|2hmfA3|4e-18|29.4|85/95|d.58.18.10| HM:SCP:REP 1->288|2hmfA1|2.5e-65|37.0|281/0|c.73.1.3|1/1|Carbamate kinase-like| HM:SCP:REP 295->358|2cdqA2|3.7e-08|21.9|64/0|d.58.18.10|1/2|ACT-like| HM:SCP:REP 370->450|2hmfA3|1.5e-21|39.5|81/0|d.58.18.10|1/1|ACT-like| OP:NHOMO 1589 OP:NHOMOORG 1019 OP:PATTERN 11-1--1111111111-1111111-11-11111111111111111111111112222-1-211-2-12 1221111111111111111-111111111111111111111121111111111111111111111111121111111111112111113322231112112313332233111111111111111222222222221112211111111-111111111111111111111111111111111111111112332222222222222222333332223222211333333322222222222222222222212-1221111-221122-11111111111111111111111111111-------------111111111113122333333323212222111221-121121222221212211111-2211111111111111111111111111111111111-111111111111111111111111111121111111111111111111111111111-11111--111111111111111111111111111111111111-111111111111111111111111111111111111-111111111111111111111122211121111111111121111122224311111111111111111111111111111333222312424444433344443433433--1211111111133333333333333333-333333333333333333333333333333333333333333333333333213333333333331113111111111111122-22121111-1112111111111111111111111111121113--1-211-234434444445544222222222222221111111111----------1-------------------------2112222222111 ------1-----111111-111-111111111111111111111-1111112221111111111111111111111111111111111-11-11121111-11234-23-----------------------------------------------------------------12222M2221255741622243232 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 454 STR:RPRED 100.0 SQ:SECSTR cEEEEEcTTTTccHHHHHHHHHHHHHHHTTcEEEEcccTTHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEcHHHHTEEEcccTTcccEEEEcHHHHHHHHHTTcEEEEEccEEEETTccEEEccTTTHHHHHHHHHHHTTccEEEEEEcccccccccTTTcTTcccccEEEHHHHHHHHHTTcTTccGGGHHHHHHHTccEEEEETTcTTcccEEEEccccccTTcccEEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHTTccEEEEEcccTTccEEEEEEGGGHHHHHHHHHHTTccccEEEEEEEEEEEEEEEEcTTTTTcTTHHHHHHHHHHHHTccccEEEccccccEEEEEEEGGGHHHHHHHHHHHHTTccccc DISOP:02AL 450-455| PSIPRED cEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcHHHEEEEEcccccccEEccccHHHHHHHcccccEEEEccEEEEcccccEEEEccccHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHccccEEEEEcccccccccEEEEccccccccEEEEEEcccEEEEEEEcccccccccHHHHHHHHHHHccccEEEEEccccEEEEEEEHHHccHHHHHHHHHHHHHHcccccEEEEcccEEEEEEcccccccccHHHHHHHHHHHccccEEEEEEEcccEEEEEEEcHHHHHHHHHHHHHHHHHccccc //