[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54773.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->81 PF04129 * Vps52 0.0003 17.6 68/511  
:BLT:SWISS 4->112 YHGE_BACSU 4e-07 22.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54773.1 GT:GENE ACF54773.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2071622..2071960) GB:FROM 2071622 GB:TO 2071960 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF54773.1 GB:DB_XREF GI:194356325 LENGTH 112 SQ:AASEQ MADGSGKLAEGGTKLTSGLEDLQTGLASLGQGLGNASDQLKSVSTESKNAEILSNPLNLSKTDNDQVPVNGIAIAPYMISVALFFAAISTNMIFAKLPSGRHPESRWAWLKS GT:EXON 1|1-112:0| BL:SWS:NREP 1 BL:SWS:REP 4->112|YHGE_BACSU|4e-07|22.0|109/100| HM:PFM:NREP 1 HM:PFM:REP 13->81|PF04129|0.0003|17.6|68/511|Vps52| OP:NHOMO 75 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1111--11111--111---1---1---111211------------------------2--------22----111-1-1111111111111-1-11-11-1111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,106-107| PSIPRED cccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHc //