[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54790.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.10c.1.2c.1.20
:200 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   57->191 2cw6F PDBj 6e-06 15.4 %
:RPS:SCOP  25->102 1efzA  c.1.20.1 * 7e-04 18.6 %
:RPS:SCOP  77->185 1w37A  c.1.10.1 * 1e-04 15.8 %
:HMM:SCOP  17->135 1yxyA1 c.1.2.5 * 0.00016 29.6 %
:RPS:PFM   26->106 PF02679 * ComA 3e-04 30.8 %
:HMM:PFM   48->102 PF03808 * Glyco_tran_WecB 9.9e-05 28.3 53/172  
:HMM:PFM   89->124 PF02602 * HEM4 0.001 25.0 36/229  
:BLT:SWISS 28->102 DAPA_PYRAE 3e-04 35.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54790.1 GT:GENE ACF54790.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1633955..1634557) GB:FROM 1633955 GB:TO 1634557 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF54790.1 GB:DB_XREF GI:194356342 LENGTH 200 SQ:AASEQ MEPIDPSAKMLEETQEIVAGXVASVETLKRIEELGFDFVCLTGNPGTGVSNQEIIKAVQSAKENFSGLIIAGKMHGAGVNEPVAELSVAEQLLEAGADVILVPAVGTVPAFHDQELREVVDLVHSKGGLVLSAIGTSQETSDTDTIKEIALRNKICGVDIQXIGDAGYGGLATVDNIYALSKAIRGVRHTVSRLARSVNR GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 28->102|DAPA_PYRAE|3e-04|35.2|71/301| RP:PDB:NREP 1 RP:PDB:REP 57->191|2cw6F|6e-06|15.4|130/288| RP:PFM:NREP 1 RP:PFM:REP 26->106|PF02679|3e-04|30.8|78/240|ComA| HM:PFM:NREP 2 HM:PFM:REP 48->102|PF03808|9.9e-05|28.3|53/172|Glyco_tran_WecB| HM:PFM:REP 89->124|PF02602|0.001|25.0|36/229|HEM4| GO:PFM:NREP 1 GO:PFM GO:0019295|"GO:coenzyme M biosynthetic process"|PF02679|IPR003830| RP:SCP:NREP 2 RP:SCP:REP 25->102|1efzA|7e-04|18.6|70/372|c.1.20.1| RP:SCP:REP 77->185|1w37A|1e-04|15.8|101/293|c.1.10.1| HM:SCP:REP 17->135|1yxyA1|0.00016|29.6|108/0|c.1.2.5|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN ----------------1--------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---1-----------------------111--11--1-1----11-------------111------11111-11-------------1-------------------------------------1--------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111--------------------------------1------------------------------------------1---------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 191 STR:RPRED 95.5 SQ:SECSTR HHHHHHHHHHTTcEEEEEEcTTccHHHHHHHHHHcccEEEEEcTTccccccHHHHHHHHHTcEEEEEEETTTccTTTccccHHHHHHHHHHHHHHTccEEEEEHHETTccccHHHHHHHHHHHHHHccGGGEEEEEcHHHcTTccHHHHHHHHHHHTccEEEEcTTccccccccccHHHHHHHHHHHTccc######### DISOP:02AL 1-1,199-201| PSIPRED ccccccccccccccEEccccccccHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHccEEEEEEEccccccccccHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHcc //