[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54793.1
DDBJ      :             transcriptional activator MutR, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:287 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->286 2aw6A PDBj 1e-22 13.5 %
:RPS:SCOP  1->63 2aw6A1  a.35.1.11 * 6e-07 17.5 %
:HMM:SCOP  2->62 2awiA1 a.35.1.11 * 3.5e-08 19.7 %
:HMM:PFM   9->59 PF01381 * HTH_3 4e-06 25.5 51/55  
:HMM:PFM   206->266 PF01644 * Chitin_synth_1 0.00048 19.7 61/163  
:BLT:SWISS 5->283 RGG_STRGC 4e-28 25.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54793.1 GT:GENE ACF54793.1 GT:PRODUCT transcriptional activator MutR, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 989826..990689 GB:FROM 989826 GB:TO 990689 GB:DIRECTION + GB:PRODUCT transcriptional activator MutR, putative GB:NOTE identified by match to protein family HMM TIGR01716 GB:PROTEIN_ID ACF54793.1 GB:DB_XREF GI:194356345 LENGTH 287 SQ:AASEQ MEHLGKVFREFRTSGNYSLKEAAGESCSTSQLSRFELGESDLAVSRFFEILDNIHVTIENFMDKARNFHNHEHVSMMAQIIPLYYSNDIAGFQKLQREQLEKXKSSTTPLYFELNWILLQGLICQRDASYDMKQDDLDKVADYLFKTEEWTMYELILFGNLYSXYDVDYVTRIGREVMEREEFYQEISRHKRLVLILALNCYQHCLEHSSFYNANYFEAYTEKIIDKGIKLYERNVFHYLKGFALYQKGQCKEGCKQMQEAIHIFDVLGLPEQVAYYQEHYEKFVKS GT:EXON 1|1-287:0| BL:SWS:NREP 1 BL:SWS:REP 5->283|RGG_STRGC|4e-28|25.7|276/100| RP:PDB:NREP 1 RP:PDB:REP 1->286|2aw6A|1e-22|13.5|282/287| HM:PFM:NREP 2 HM:PFM:REP 9->59|PF01381|4e-06|25.5|51/55|HTH_3| HM:PFM:REP 206->266|PF01644|0.00048|19.7|61/163|Chitin_synth_1| RP:SCP:NREP 1 RP:SCP:REP 1->63|2aw6A1|6e-07|17.5|63/69|a.35.1.11| HM:SCP:REP 2->62|2awiA1|3.5e-08|19.7|61/0|a.35.1.11|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 177 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------23323---------------------------11-1--1-1--11--1---4252223544422244663343433344434444434311665111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 287 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHHHHHTTccHHHHHTTTccHHHHHHHHTTcccccHHHHHHHHHHHTccHHHHHHHHTTcccTTcHHHHHHHHHHHHHHcGGGHHHHHHHHGGGTTTcHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHTTTccHHHHHHHHGGGccccccccHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHTTH DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHccccHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcc //