[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54799.1
DDBJ      :             response regulator TCS06
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  861/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:217 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->215 2oqrA PDBj 3e-27 32.1 %
:RPS:PDB   1->213 3c3wB PDBj 1e-26 16.9 %
:RPS:SCOP  1->117 1a0oA  c.23.1.1 * 2e-25 26.5 %
:RPS:SCOP  122->215 1ys6A1  a.4.6.1 * 4e-19 32.3 %
:HMM:SCOP  1->128 1k66A_ c.23.1.1 * 2.7e-35 39.1 %
:HMM:SCOP  116->218 1ys7A1 a.4.6.1 * 1.1e-20 37.3 %
:RPS:PFM   3->102 PF00072 * Response_reg 1e-12 41.0 %
:RPS:PFM   145->215 PF00486 * Trans_reg_C 4e-09 42.9 %
:HMM:PFM   3->112 PF00072 * Response_reg 2.5e-28 39.1 110/112  
:HMM:PFM   143->215 PF00486 * Trans_reg_C 3.3e-21 43.1 72/77  
:HMM:PFM   103->131 PF00312 * Ribosomal_S15 0.00081 25.0 28/83  
:BLT:SWISS 1->215 VANR_ENTFA 6e-33 35.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54799.1 GT:GENE ACF54799.1 GT:PRODUCT response regulator TCS06 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2032189..2032842) GB:FROM 2032189 GB:TO 2032842 GB:DIRECTION - GB:PRODUCT response regulator TCS06 GB:NOTE identified by match to protein family HMM PF00072; match to protein family HMM PF00486 GB:PROTEIN_ID ACF54799.1 GB:DB_XREF GI:194356351 LENGTH 217 SQ:AASEQ MNILVADDEEMIREGIAAFLTEEGYHVIMAKDGQEVLEKFQDLPIHLMVLDLMMPRKSGFEVLKEINQKHDIPVIVLSALGDETTQSQVFDLYADDHVTKPFSLVLLVKRIKALIRRYYVIEDIWRYQDVTVDFTSYKAHYKNEEIDLKPKELLVLKCLIQHKNQVLSREQILEEISKDVADLPCDRVVDVYIRTLRKKLALDCIVTVKNVGYKISL GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 1->215|VANR_ENTFA|6e-33|35.2|213/220| BL:PDB:NREP 1 BL:PDB:REP 2->215|2oqrA|3e-27|32.1|212/226| RP:PDB:NREP 1 RP:PDB:REP 1->213|3c3wB|1e-26|16.9|201/210| RP:PFM:NREP 2 RP:PFM:REP 3->102|PF00072|1e-12|41.0|100/111|Response_reg| RP:PFM:REP 145->215|PF00486|4e-09|42.9|70/77|Trans_reg_C| HM:PFM:NREP 3 HM:PFM:REP 3->112|PF00072|2.5e-28|39.1|110/112|Response_reg| HM:PFM:REP 143->215|PF00486|3.3e-21|43.1|72/77|Trans_reg_C| HM:PFM:REP 103->131|PF00312|0.00081|25.0|28/83|Ribosomal_S15| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 1->117|1a0oA|2e-25|26.5|117/128|c.23.1.1| RP:SCP:REP 122->215|1ys6A1|4e-19|32.3|93/106|a.4.6.1| HM:SCP:REP 1->128|1k66A_|2.7e-35|39.1|128/149|c.23.1.1|1/1|CheY-like| HM:SCP:REP 116->218|1ys7A1|1.1e-20|37.3|102/0|a.4.6.1|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 10467 OP:NHOMOORG 905 OP:PATTERN -----------------------1---2-1-1---1--1111132-3B17325-1-1-11-------- 7GO6G466778645A9988-8C4488888889FABB9EGDA8DEB9776784BAE45711FDK6J5FKGK8333344458IA724576AAQL-D22---55G588L7MAI----------1111252354246492NMMRPG8DY5jXhbTSDHIFH6568A8JJGDhbtK584554584544AA588453ABJVVWVWTVWHWTXXVSJLGEDGVXeACEYBIHA99A9Ajc8AAABAA9AAAAAAA89A96B675CC645466666CC655675686DED866899988888888888555556666765596666466677aLNeRRRWVVWUSMFfXX9FHDSKI8BEHPD6faNFB7667897B8429GIAB99966666FBKIHC8DFJDDI8878888877C-BCCCDIDI8H91LDDJIEHLKJHGCL8C8B8CDADD8F9AAAAAAAA7AA89IDD2222222222332422323223323222236BC458BA8CLPSQUJHEEECMMOOGEGFBGSJMGKKT12HKHNAFCAMDFHI7GMFAAAAA51111111973FKOCdZI97K97HNBB82dNcONUTFFEGGEKMEMQ9886666666323433333ES9DJ44HE9EGKM7IFCJILKIBKEJJJKGIFJMJI--44838------FDCFDC9CDDDCDDECC-DEDCCCCCCEDCCCCCCCCHFGAD889CBCCCCCCBCCBCBCCFBCDBBCC81BBBBBBBBBBBB--2B3433356559BO9O434433244443124DCABD7B88ADFOMPOLVVYKPSTSHNNQ3212132128DEEPHHHHHJKLKMMLB9D98ABA6656--V388558811111111412-------------------------47577878785E3 ----32--------1---------------------------------------------------------------------------------11-----------1------------------------------------------------1----2-1-------3-124--111-11--7---1-7---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 217 STR:RPRED 100.0 SQ:SECSTR EEEEEEcccHHHHHHHHHHHHTcTTEEEEEccHHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHcTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHGGHHHHHHHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHHHHHccccETTcccHTccHHHHHHHHHHHHHHTTccHHHHHHHHTcEEcc PSIPRED cEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHccccccccEEEccEEEEcccEEEEEccEEEcccHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccEEHHHHHHHHHHcccccEEEEcccEEEEEc //