[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54803.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->188 PF09605 * Trep_Strep 1e-37 49.5 %
:HMM:PFM   3->188 PF09605 * Trep_Strep 3.8e-59 44.0 184/186  
:BLT:SWISS 6->93 NART_STAHJ 5e-04 29.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54803.1 GT:GENE ACF54803.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(156623..157192) GB:FROM 156623 GB:TO 157192 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM TIGR02185 GB:PROTEIN_ID ACF54803.1 GB:DB_XREF GI:194356355 LENGTH 189 SQ:AASEQ MKKSILTTLLFAVLYFLCMGIGVLLGNLFDQTGNMFYAPAFTALVGGSVYMILVAKVPRFGAITTIGLVIALFFLGTKHGAGSFLPGIICGLLADGVAHLGKYKDKTKNFLSFIIFAFSTTGPILLMWIAPKAYMATLLARGKSQEYIDRIMVAPNPGTVLLFIASIVIGALVGALIGQALSKKFAQKI GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 6->93|NART_STAHJ|5e-04|29.5|88/100| TM:NTM 5 TM:REGION 6->28| TM:REGION 36->58| TM:REGION 80->102| TM:REGION 114->136| TM:REGION 159->181| RP:PFM:NREP 1 RP:PFM:REP 3->188|PF09605|1e-37|49.5|184/186|Trep_Strep| HM:PFM:NREP 1 HM:PFM:REP 3->188|PF09605|3.8e-59|44.0|184/186|Trep_Strep| OP:NHOMO 59 OP:NHOMOORG 54 OP:PATTERN --------------------------------1----------------------------------- -----1------------------------------------------------------11---------1111-11--3--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111211--11111111111111111111111111-111111-----1----------------------1-----22------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,189-190| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //