[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54805.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  198/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:209 amino acids
:PSIPRED
:BLT:PDB   1->204 2oukB PDBj 2e-44 43.6 %
:RPS:PDB   2->198 3b5jA PDBj 1e-42 29.6 %
:RPS:SCOP  1->201 1b0uA  c.37.1.12 * 8e-46 38.3 %
:HMM:SCOP  4->208 1ii8.1 c.37.1.12 * 1e-63 41.9 %
:RPS:PFM   26->54 PF03215 * Rad17 5e-04 51.7 %
:RPS:PFM   41->162 PF00005 * ABC_tran 1e-20 48.3 %
:HMM:PFM   41->162 PF00005 * ABC_tran 2.6e-26 40.0 115/118  
:HMM:PFM   126->206 PF02463 * SMC_N 6.3e-05 31.5 73/220  
:HMM:PFM   29->48 PF03205 * MobB 7e-05 50.0 20/137  
:BLT:SWISS 1->207 GLNQ_BACSU 4e-47 43.5 %
:PROS 134->148|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54805.1 GT:GENE ACF54805.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1376757..1377386) GB:FROM 1376757 GB:TO 1377386 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF54805.1 GB:DB_XREF GI:194356357 LENGTH 209 SQ:AASEQ MLELRNINKVFGDKQILSNFSLSIPEKQILAIVGPSGGGKTTLLRMLAGLETIDSGQIFYNGQPLELDELQKRNLLGFVFQDFQLFPHLSVLDNLTLSPVKTMGMKQEEAEKKASGLLEQLGLGGHAEAYPFSLSGGQKQRVALARAMMIDPEIIGYDEPTSALDPELRLEVEKLILQNRELGMTQIVVTHDLQFAENIADVLLKVEPK GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 1->207|GLNQ_BACSU|4e-47|43.5|207/242| PROS 134->148|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->204|2oukB|2e-44|43.6|204/241| RP:PDB:NREP 1 RP:PDB:REP 2->198|3b5jA|1e-42|29.6|196/243| RP:PFM:NREP 2 RP:PFM:REP 26->54|PF03215|5e-04|51.7|29/379|Rad17| RP:PFM:REP 41->162|PF00005|1e-20|48.3|118/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 41->162|PF00005|2.6e-26|40.0|115/118|ABC_tran| HM:PFM:REP 126->206|PF02463|6.3e-05|31.5|73/220|SMC_N| HM:PFM:REP 29->48|PF03205|7e-05|50.0|20/137|MobB| GO:PFM:NREP 5 GO:PFM GO:0005634|"GO:nucleus"|PF03215|IPR004582| GO:PFM GO:0006281|"GO:DNA repair"|PF03215|IPR004582| GO:PFM GO:0007049|"GO:cell cycle"|PF03215|IPR004582| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->201|1b0uA|8e-46|38.3|201/258|c.37.1.12| HM:SCP:REP 4->208|1ii8.1|1e-63|41.9|203/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 55348 OP:NHOMOORG 1175 OP:PATTERN aaMBUOJKYXXUXTbOrMVTQTQZ*QTmrWjXJCDEFDIIIGFSaUWoNT**l9TdSYZOTKMGb2BB XexS*ijjvvxbhUaXaRQ-QnCCf*RRRRRUzrst****Y*d****lvwmR***SYjDE***m*y****heZZZ*eeiV*pqDCEACWYTP6THLM-1HJVOPOiRcPXABAAAABBCDCCCCMWTMVbURaXfVp****PON*c*nrzihqioUWTMUORKekdp***dLWLOLMKVJNMKpejYUxmBak*************************jr***qw***wx***eqrsqsonpqqqqppdjehj*pek**jRket*zTU**fbTbqmlmpvvz*zv****w*wvusx*vvwefeddfhhihgde*rsihhtrutu***********l*q****gnpm**l***nvXM**xqdhltVcohtuQeggPfbXXNOOOMRjc***eYu****************-z**to*v***VF**************MLN**********WVWWWWWW*fkMVpb*776666666669B9DE9AFBBABBB86A5MFGIGH************************p********DQ****v*sw******cutSbOUtgMNMLNLMVTUgwqj**Wjb*sbtzgdtMefabXbnYchdefx*a*ONPUIRRRSPJDDFFFFFFFIXHIMSR*z*Y*YjPXR*UaeeaUWhaWXXWbebZge5-FNZSN331433****f************-************************qrouwrttvvvvvstvttr**x*****c7************33LLFIEFGSTVTVQ*v*hfecdeNSWRRYQVkRTVUTIXISW*l*************q***HHHFHIIHHPnus*wwwxw*****UVVSRTSQRSHHGH88QXWVPPPPBA8AA9BA*DdFCCEI-GHHEOHDSSQBIREKI88Agr*bbt*wtuFiQ 2234rjK1gOBCViSLEJGFKOJQITJHHDEBEMJKELIIJIICAALGKRJKWWJLMBGGGH87C7A858B68A99B59C999B7B57-HSCEJFMAABG97HQLJ8VcnrbibrifPLHGLbOwrB*H**q4wWtMLIDkHOsaDTJIEfHC*JaXUyNn*RvRiE*il*iliQGLJH*JJHIV*u**F**OSthnkf ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEEEEccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHEEEEEEcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHccEEEEEccc //