[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54809.1
DDBJ      :             alpha-amylase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  161/915 : Eukaryota  72/199 : Viruses  0/175   --->[See Alignment]
b.71.1c.1.8c.154.1c.52.1
:484 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->479 1wpcA PDBj e-142 50.6 %
:RPS:PDB   2->479 3bc9A PDBj 3e-83 37.2 %
:RPS:SCOP  18->142 3bobA1  c.154.1.1 * 9e-45 18.6 %
:RPS:SCOP  130->274 2ot9A1  c.52.1.33 * 6e-10 9.0 %
:RPS:SCOP  396->479 1bliA1  b.71.1.1 * 8e-34 40.5 %
:HMM:SCOP  4->394 1e43A2 c.1.8.1 * 4.9e-105 31.1 %
:HMM:SCOP  395->482 1e43A1 b.71.1.1 * 5.2e-36 56.8 %
:RPS:PFM   25->371 PF00128 * Alpha-amylase 5e-22 37.6 %
:RPS:PFM   429->479 PF09154 * DUF1939 4e-13 56.9 %
:HMM:PFM   27->375 PF00128 * Alpha-amylase 1.5e-38 25.3 292/316  
:HMM:PFM   347->404 PF02324 * Glyco_hydro_70 2.3e-07 36.2 58/809  
:HMM:PFM   425->480 PF09154 * DUF1939 9.1e-15 38.2 55/57  
:BLT:SWISS 3->479 AMT6_BACS7 e-142 50.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54809.1 GT:GENE ACF54809.1 GT:PRODUCT alpha-amylase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1289041..1290495 GB:FROM 1289041 GB:TO 1290495 GB:DIRECTION + GB:PRODUCT alpha-amylase GB:NOTE identified by match to protein family HMM PF00128 GB:PROTEIN_ID ACF54809.1 GB:DB_XREF GI:194356361 LENGTH 484 SQ:AASEQ MQNQTLMQYFEWYLPHDGQHWTRLAENAPHLAHLGISHVWMPPAFKATNEKDVGYGVYDLFDLGEFNQKGTVRTKYGFKEDYLQAIQALKAQGIQPMADVVLNHKAAADHREAFQVIEVDPVDRTVELGEPFTINGWTSFTFDGRQDTYNDFHWHWYHFTGTDYDAKRRKSGIYLIQGXNKGWANEELVDNENGNYDYLMYADLDFKHPEVIQNIYDWADWFMETTGVAGFRLDAVKHIDSFFMRNFIRDMKEKYGDDFYVFGEFWNPDKEANLDYLEKTEEHFDLVDVRLHQNLFEASQAGANYDLRGIFTDSLVELKPDKAVTFIDNHDTQRGQALESTVEEWFKPAAYALILLRQDGLPCVFYGDYYGISGQYAQEDFKEILDRLLAIRKDLAYGEQNDYFDHANCIGWVRSGAENQSPIAVLISNDQENSKSMFVGQEWTNQTFVDLLGNHQGQVTIDEEGYGQFPVSARSVSVWAVNTI GT:EXON 1|1-484:0| BL:SWS:NREP 1 BL:SWS:REP 3->479|AMT6_BACS7|e-142|50.6|474/518| BL:PDB:NREP 1 BL:PDB:REP 3->479|1wpcA|e-142|50.6|474/481| RP:PDB:NREP 1 RP:PDB:REP 2->479|3bc9A|3e-83|37.2|457/585| RP:PFM:NREP 2 RP:PFM:REP 25->371|PF00128|5e-22|37.6|274/296|Alpha-amylase| RP:PFM:REP 429->479|PF09154|4e-13|56.9|51/57|DUF1939| HM:PFM:NREP 3 HM:PFM:REP 27->375|PF00128|1.5e-38|25.3|292/316|Alpha-amylase| HM:PFM:REP 347->404|PF02324|2.3e-07|36.2|58/809|Glyco_hydro_70| HM:PFM:REP 425->480|PF09154|9.1e-15|38.2|55/57|DUF1939| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00128|IPR006047| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00128|IPR006047| GO:PFM GO:0043169|"GO:cation binding"|PF00128|IPR006047| RP:SCP:NREP 3 RP:SCP:REP 18->142|3bobA1|9e-45|18.6|113/209|c.154.1.1| RP:SCP:REP 130->274|2ot9A1|6e-10|9.0|145/179|c.52.1.33| RP:SCP:REP 396->479|1bliA1|8e-34|40.5|84/90|b.71.1.1| HM:SCP:REP 4->394|1e43A2|4.9e-105|31.1|386/0|c.1.8.1|1/1|(Trans)glycosidases| HM:SCP:REP 395->482|1e43A1|5.2e-36|56.8|88/0|b.71.1.1|1/1|Glycosyl hydrolase domain| OP:NHOMO 302 OP:NHOMOORG 237 OP:PATTERN -------------------------------------------------------2-112-------- ------1--------------------------------------1---------1-----------111--111-------------1111-1-----211-1-11-11--------------------1---1----1------1-1------------------121----------------------1-111111---1-111---11--111-21-154--------1------------------------------------------1--1111111111111111111111----1111----1--111---1---1--------1-1-----------11--1--------3---------1--------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------1----111111111111-1111111111111-11--1111-----1111111111-1111111111111--1-------------------------------------------------------1------------------------------------11-----------------------------------------------------------1---1111--------1 --11----------1221111112223111121111111111111111------11311222---------------------------111211121111-1--------------------------------------------------------------2----------214R2112-31211-1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 483 STR:RPRED 99.8 SQ:SECSTR GccccEEEcccTTTGGGGGHHHHHHHHHHHHHHHTccEEEcccccEETTGGcccccEEETTcccccccTTccccTTccHHHHHHHHHHHHHTTcEEEEEEcccEEccccEEEEEEccTTccccTTEEcccccEEEEEEEcccTTTTTccccccccGGGEEEEEEETTTTEEEEEEcTTcccccccccccccccTTccccccEEEcTTcHHHHHHHHHHHHHHHHTTcccEEEETTGGGccHHHHHHHHHHHHHTcccccEEEEccccccHHHHHHHHHHHccTTEEEcHHHHHHHHHHTTcccGGGGGcccGGGcHTTTGGGEEEccccTTTccccccccccccccHHHHHHHHHHccccEEEEEHHHHHTccccccccccHHHHHHHHHHHHHTccccEEEccccccEEEEEEcccTTcccEEEEEEccccccEEEEEEcccTTcEEEETTcccccEEEccTTcEEEEEEEcTcEEEEEccH# DISOP:02AL 1-1| PSIPRED ccccEEEEEEEEccccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEccHHcccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHcccccEEEEEEEHHHHHHHHHHccccHHHHHHHHHHHHHHccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHccccEEEEccEEcccccccccccHHHHHHHHHHHHHHccccccEEEEEcccEEEEEEEEcccccEEEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEccccEEEEEEcccEEEEEEEEEc //