[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54812.1
DDBJ      :             glycosyl transferase, group 1 family protein
Swiss-Prot:             

Homologs  Archaea  42/68 : Bacteria  507/915 : Eukaryota  68/199 : Viruses  0/175   --->[See Alignment]
c.87.1
:441 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->312 3c48A PDBj 6e-16 28.2 %
:RPS:PDB   1->380 3c48A PDBj 2e-41 21.9 %
:RPS:SCOP  5->376 2iv7A1  c.87.1.8 * 2e-42 13.2 %
:HMM:SCOP  1->380 1rzuA_ c.87.1.8 * 4.4e-74 28.1 %
:RPS:PFM   210->353 PF00534 * Glycos_transf_1 5e-15 36.6 %
:HMM:PFM   196->345 PF00534 * Glycos_transf_1 1.6e-33 36.0 150/172  
:BLT:SWISS 1->332 Y1607_METJA 3e-15 24.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54812.1 GT:GENE ACF54812.1 GT:PRODUCT glycosyl transferase, group 1 family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 959405..960730 GB:FROM 959405 GB:TO 960730 GB:DIRECTION + GB:PRODUCT glycosyl transferase, group 1 family protein GB:NOTE identified by match to protein family HMM PF00534 GB:PROTEIN_ID ACF54812.1 GB:DB_XREF GI:194356364 LENGTH 441 SQ:AASEQ MRIGLFTDTYFPQVSGVATSIRTLKTELEKQGHAVFIFTTTDKDVNRYEDWQIIRIPSVPFFAFKDRRFAYRGFSKALEIAKQYQLDIIHTQTEFSLGLLGIWIARELKIPVIHTYHTQYEDYVHYIAKGMLIRSSMVKYLVRGFLHDVDGVICPSEIVRDLLSDYKVKVEKRVIPTGIELAKFERPEIKQENLKELRSKLGIQDGEKTLLSLSRISYEKNIQAVLAAFADVLKEEDKVKLVVAGDGPYLNDLKEQAQNLEIQDSVIFTGMIAPSETALYYKAADFFISASTSETQGLTYLESLASGTPVIAHGNPYLNNLISDKMFGTLYYGEHDLAGAILEALIATPDMNEHTLSEKLYEISAENFGKRVHEFYLDAIISNNFQKDLAKDDTVSQRIFKTVLYLQQQVVAVPVKGSRRMLKASKTQLISMRDYWKDHEE GT:EXON 1|1-441:0| BL:SWS:NREP 1 BL:SWS:REP 1->332|Y1607_METJA|3e-15|24.0|325/390| SEG 231->243|dvlkeedkvklvv| BL:PDB:NREP 1 BL:PDB:REP 1->312|3c48A|6e-16|28.2|301/399| RP:PDB:NREP 1 RP:PDB:REP 1->380|3c48A|2e-41|21.9|370/399| RP:PFM:NREP 1 RP:PFM:REP 210->353|PF00534|5e-15|36.6|142/165|Glycos_transf_1| HM:PFM:NREP 1 HM:PFM:REP 196->345|PF00534|1.6e-33|36.0|150/172|Glycos_transf_1| GO:PFM:NREP 1 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00534|IPR001296| RP:SCP:NREP 1 RP:SCP:REP 5->376|2iv7A1|2e-42|13.2|356/370|c.87.1.8| HM:SCP:REP 1->380|1rzuA_|4.4e-74|28.1|377/477|c.87.1.8|1/1|UDP-Glycosyltransferase/glycogen phosphorylase| OP:NHOMO 884 OP:NHOMOORG 617 OP:PATTERN 11--------------1----1--2-1221211--111222121316311636-14112311121-1- 2-1-12-122211131111-12--21111111211111221-----22-22123311211-1111-11-11-111-------122-2-1221-211----11-111232----------------1111111111111164--12-5243222111121111122226793111111111111222114411--11111221121122112331-1211-21---111111-5111111111111111-111121111111111111121111111111111111111111111111111111111111111111111111111--321111111-1-1-222----13111--233332413112--21--221-1221-----1-2-121111112----------1----------1--122111-111--111-1----------------------1122------------------------------21231111111111111111122111111111121112-1221121----1---11-11121---------1-532-12--322-1111--11-11-22-21-1-111-1-----------1111-1111-1-22---121-1-----------------11-------112----------1--------------------------------------------------------1-------------------------------111-133--1-------------111-211--2--1121-1-11-1111111---------1--------------1111111111------3-111111111111111-1--11-----11--------------121--12211431 1111111-1---11---1-11-12122--1111-----------11--2211111--21----11-----1------------1--1--12--1-1---1--2211---------------------------------------------------------1---------1-12-2E12111224213112----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 441 STR:RPRED 100.0 SQ:SECSTR cEEEEEcTTccTTcccHHHHHHHHHHHHHHTTcEEEEEEEcccGGGccEEETTEEEEEEccccccGGGGHHHHHHHHHHHHHHHTccccEEEEEHHHHHHHHHHHHHHTccEEEEccccHHHHcccHHHHccHHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHHcccGGGEEccccccTTTcccccHHHHHHHHHHHHTTcccccEEEEEEccccGGGcHHHHHHHHHHHHHHcTTccEEEEEEcccccHHHHHHHHTTcTTTEEEEccccHHHHHHHHHHccEEEEccccccccHHHHHHHHTTccEEEEccTTHHHHcccTTTEEEEccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTcHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHTcGGGcHHHHHHHHHTTccccc DISOP:02AL 382-396,438-442| PSIPRED cEEEEEcccccccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccEEEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcccccHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHccccccEEEEcccccHHHcccccccccHHHHHHHHcccccccEEEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHccEEEEccccccccHHHHHHHHccccEEEcccccHHHHHcccccEEEEccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccc //