[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54816.1
DDBJ      :             ABC transporter,  permease protein
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  517/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:309 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->210 3fh6F PDBj 5e-09 25.8 %
:BLT:PDB   193->231 2r6gG PDBj 8e-05 43.6 %
:RPS:PDB   193->229 3dhwA PDBj 4e-10 37.8 %
:RPS:SCOP  58->302 2r6gG1  f.58.1.1 * 1e-15 15.1 %
:HMM:PFM   103->302 PF00528 * BPD_transp_1 1.9e-16 20.9 172/185  
:HMM:PFM   85->105 PF02038 * ATP1G1_PLM_MAT8 0.00049 52.4 21/50  
:HMM:PFM   2->40 PF04401 * DUF540 0.0001 38.5 39/188  
:BLT:SWISS 17->301 YTEP_BACSU 3e-45 32.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54816.1 GT:GENE ACF54816.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 90318..91247 GB:FROM 90318 GB:TO 91247 GB:DIRECTION + GB:PRODUCT ABC transporter, permease protein GB:NOTE identified by match to protein family HMM PF00528 GB:PROTEIN_ID ACF54816.1 GB:DB_XREF GI:194356368 LENGTH 309 SQ:AASEQ MKKFSKTLRDNWIFLLMVLPGALWLILFFYIPVFGNVVAFKDYHMTSNGFIXSIINSKWVGLDNFRFLFSSRDAFIITRNTVLYNLGFIFLGLVVSVGIAIILSELRSKRMVKIFQTSMLFPYFLSWVIISFFTDAFLNIDKGVFNHLLESLGLKEVNFYADLGIWPYLLLFLGIWKGFGYSSVMYYATIMGIDPTYYEAATVDGASKWQRIRNVTIPQLTPLVTVLTILAVGNIFRADFGLFYQIPHNAGQLYNVTNVLDVYVFNGLTQTADIGMAAAAGLYQSVVGLILVILSNLLARRVDPNSALF GT:EXON 1|1-309:0| BL:SWS:NREP 1 BL:SWS:REP 17->301|YTEP_BACSU|3e-45|32.4|278/321| TM:NTM 6 TM:REGION 13->35| TM:REGION 81->103| TM:REGION 118->140| TM:REGION 158->180| TM:REGION 219->241| TM:REGION 276->298| BL:PDB:NREP 2 BL:PDB:REP 16->210|3fh6F|5e-09|25.8|190/316| BL:PDB:REP 193->231|2r6gG|8e-05|43.6|39/284| RP:PDB:NREP 1 RP:PDB:REP 193->229|3dhwA|4e-10|37.8|37/203| HM:PFM:NREP 3 HM:PFM:REP 103->302|PF00528|1.9e-16|20.9|172/185|BPD_transp_1| HM:PFM:REP 85->105|PF02038|0.00049|52.4|21/50|ATP1G1_PLM_MAT8| HM:PFM:REP 2->40|PF04401|0.0001|38.5|39/188|DUF540| RP:SCP:NREP 1 RP:SCP:REP 58->302|2r6gG1|1e-15|15.1|225/284|f.58.1.1| OP:NHOMO 2188 OP:NHOMOORG 540 OP:PATTERN ----1----1--1-2-4---1---41151-3-----------------------123-11132----- ----W112223-1-11122-2-1123222222-212-2244133DvR27AA3FFF115--4264A14EKD46333D831---2-----------------------------------------------------57766---73221311-11111-1111222-333--1-----1----84155BC-833222222331122222QI994822354A28457677668*111111111111111-1---431-22--11122--22-----31231214333411555556555553222233332222355---5554C4-281111111514B2--1444c-25223A--231---G---884D1-1-------11111--A641--4254233223323226---5--3-17F--QKKANKHROOMI11---5A54335674--------2--1---1---------------------------------1--2222222222--111224322211-2141211--2226-122114545-------3--------------------1----1111---------11-112----------1-------------------14-------2--------------------------------1543-312222222222-222222232222122222144444--112111111111111114-212222--366666666666---------11111-548--------------1----------------1111122221122-----------11--------11111111111111111--------------------211111-11-121-111---122---5IF768N5B8-1- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------2--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 68.3 SQ:SECSTR ###############ccHHHHHHHHHHHTHHHHHHHHTcccccccccc###ccHHHHHHHHHTTTHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH#TccccccHHHHHHHHHHHHHccHHHHHHHHHHc#cccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHH############################################################################## DISOP:02AL 1-2,306-308| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //