[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54818.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->48 PF10439 * Bacteriocin_IIc 1.5e-06 26.8 41/65  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54818.1 GT:GENE ACF54818.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 147292..147525 GB:FROM 147292 GB:TO 147525 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF54818.1 GB:DB_XREF GI:194356370 LENGTH 77 SQ:AASEQ MLNLQFAETMELTEAELQDVRGGNLVNSMGGGGRSGISGWGVPGIYPGWGNQGMSPNRGAFDWTIDLADGLFGRRRR GT:EXON 1|1-77:0| SEG 22->44|ggnlvnsmggggrsgisgwgvpg| HM:PFM:NREP 1 HM:PFM:REP 8->48|PF10439|1.5e-06|26.8|41/65|Bacteriocin_IIc| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,76-78| PSIPRED ccccccHHHHHHHHHHHHHccccccHHHcccccccccccccccccccccccccccccccEEEEEEEEccccHHHccc //