[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54831.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54831.1 GT:GENE ACF54831.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(973606..973821) GB:FROM 973606 GB:TO 973821 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF54831.1 GB:DB_XREF GI:194356383 LENGTH 71 SQ:AASEQ MFELTYKDCYHVERTLKYEDHEALMLTLSGCVTLPDTLYVTSLTFRGKKVYQGLVGDLYRFLSHADFLHQN GT:EXON 1|1-71:0| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111-------------111---111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 71-72| PSIPRED cEEEEEEEHHHcEEEEEEccHHHHHHHHHHHEEcccccEEEEEEEccEEEEcccHHHHHHHHHHHHHHccc //