[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54833.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.3
:290 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  144->258 1bqqT  b.40.3.1 * 7e-04 16.4 %
:HMM:PFM   32->101 PF11949 * DUF3466 8e-05 20.0 65/599  
:BLT:SWISS 59->169 SP6D_BACSU 1e-04 34.3 %
:BLT:SWISS 149->265 HEM1_CHLAB 5e-04 30.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54833.1 GT:GENE ACF54833.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 804848..805720 GB:FROM 804848 GB:TO 805720 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF54833.1 GB:DB_XREF GI:194356385 LENGTH 290 SQ:AASEQ MKKSRKLATLGICSALFLGLAACQQQHATSEGTNQRQSSSAKVPWKASYTNLNNQVSTEEVKSLLSAHLDPNSVDAFFNLVNDYNTIVGSTGLSGDFTSFTHTEYDVEKISHLWNQKKGDFVGTNCRINSYCLLKNSVTIPKLEKNDQLLFLDNDAIDKGKVFDSQDKEEFDILFSRVPTEATTDVKVHAEKMETFFSQFQFNEKARMLSVVLHDNLDGEYLFVGHVGVLVPTDDGFLFVEKLTFEEPYQAIKFASKEDCYKYLGTKYADYTGEGLAKPFIMDNDKWVKL GT:EXON 1|1-290:0| BL:SWS:NREP 2 BL:SWS:REP 59->169|SP6D_BACSU|1e-04|34.3|108/575| BL:SWS:REP 149->265|HEM1_CHLAB|5e-04|30.6|111/100| HM:PFM:NREP 1 HM:PFM:REP 32->101|PF11949|8e-05|20.0|65/599|DUF3466| RP:SCP:NREP 1 RP:SCP:REP 144->258|1bqqT|7e-04|16.4|110/184|b.40.3.1| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- -------------1--------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--11111111111-------------1-----------1-------------1--1----1-----1------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-8,26-43| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccEEEEccccHHHEEHHHcccccccccccccEEEcHHHHHcccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEEcccccEEEEEEEEEEEEccccEEEEEEEcccccHHHHHcccHHHHHHHHHHHHHHcccccccccEEEEccccccc //