[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54834.1
DDBJ      :             hydrolase, NUDIX family
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  73/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:151 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->151 2pqvB PDBj 8e-80 95.3 %
:RPS:PDB   19->146 2b0vA PDBj 1e-13 20.0 %
:RPS:SCOP  18->148 2b0vA1  d.113.1.1 * 2e-12 17.2 %
:HMM:SCOP  1->149 1ryaA_ d.113.1.5 * 9.4e-21 23.3 %
:RPS:PFM   19->133 PF00293 * NUDIX 4e-07 32.7 %
:HMM:PFM   23->131 PF00293 * NUDIX 1.4e-14 25.3 99/135  
:BLT:SWISS 16->123 NUDT6_MOUSE 4e-07 32.4 %
:PROS 43->64|PS00893|NUDIX_BOX

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54834.1 GT:GENE ACF54834.1 GT:PRODUCT hydrolase, NUDIX family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 127155..127610 GB:FROM 127155 GB:TO 127610 GB:DIRECTION + GB:PRODUCT hydrolase, NUDIX family GB:NOTE identified by match to protein family HMM PF00293 GB:PROTEIN_ID ACF54834.1 GB:DB_XREF GI:194356386 LENGTH 151 SQ:AASEQ MTQQDFRTKVDNTVFGVRATALILQNRKLLVTKDKGKYYIIGGAIQVNEKTEDAVVREVKEELGIKAQAGQLAFVVENRFEQDGVSYHNIEFHYLVDLLEDAPLTMQEDEKRQPCEWIDLDKLQNIQLVPAFLKTALPDWEGQLRHIHLEE GT:EXON 1|1-151:0| BL:SWS:NREP 1 BL:SWS:REP 16->123|NUDT6_MOUSE|4e-07|32.4|105/313| PROS 43->64|PS00893|NUDIX_BOX|PDOC00695| BL:PDB:NREP 1 BL:PDB:REP 2->151|2pqvB|8e-80|95.3|149/150| RP:PDB:NREP 1 RP:PDB:REP 19->146|2b0vA|1e-13|20.0|125/146| RP:PFM:NREP 1 RP:PFM:REP 19->133|PF00293|4e-07|32.7|113/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 23->131|PF00293|1.4e-14|25.3|99/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 18->148|2b0vA1|2e-12|17.2|128/146|d.113.1.1| HM:SCP:REP 1->149|1ryaA_|9.4e-21|23.3|146/160|d.113.1.5|1/1|Nudix| OP:NHOMO 107 OP:NHOMOORG 74 OP:PATTERN --------------------------------------------------1----------------- -----------------------------------------------------------------------------------------------------------1------------------------------------1-------------------------------------------------333332321133223-1----313-----1-111111----------------------------------------------2111111111--111111111111111-1111-1-1-22---222-------------1-1------1-----------------1------------------------------------------------------------111-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHcccTTcccEEEEEEcEETTEEEEEEcccEEEccEEEccTTccHHHHHHHHHHHHHcEEEEEEEEEEEEEEEETTTTEccEEEEEEEEEEEEEEcTTccccTTEEEEEEEEEHHHHHHTGGcccTHHHHHHHHHTTcccEEEHT DISOP:02AL 1-1,3-3,151-152| PSIPRED cccccccEEcccEEEEEEEEEEEEEccEEEEEEEccEEEcccccccccccHHHHHHHHHHHHHccEEEEEEEEEEEEEEEccccccEEEEEEEEEEEEcccccccccccccEEEEEEEEHHHHccccccHHHHHHHHHHccccEEEEEEcc //