[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54838.1
DDBJ      :             PTS system,  IIA component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  224/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.112.1
:117 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->84 2oq3A PDBj 3e-14 39.8 %
:RPS:PDB   2->116 1a3aA PDBj 6e-21 20.5 %
:RPS:SCOP  2->116 1a3aA  d.112.1.1 * 4e-21 20.5 %
:HMM:SCOP  2->117 1a6jA_ d.112.1.1 * 1.1e-26 28.7 %
:RPS:PFM   6->114 PF00359 * PTS_EIIA_2 4e-11 36.8 %
:HMM:PFM   3->115 PF00359 * PTS_EIIA_2 1.8e-29 30.9 110/142  
:BLT:SWISS 4->113 ULAC_ECOLI 4e-14 28.2 %
:PROS 20->36|PS00372|PTS_EIIA_TYPE_2_HIS

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54838.1 GT:GENE ACF54838.1 GT:PRODUCT PTS system, IIA component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1956136..1956489) GB:FROM 1956136 GB:TO 1956489 GB:DIRECTION - GB:PRODUCT PTS system, IIA component GB:NOTE contains potential frameshift; identified by match to protein family HMM PF00359 GB:PROTEIN_ID ACF54838.1 GB:DB_XREF GI:194356390 LENGTH 117 SQ:AASEQ MDQDKITENYPEAMIQKVEEFGPFINLGKGVAIPHARPDEGVNEIGMSMLVLEEPIYLLDNPEQEVRLLICIAAIDNESHLKALSHLTTILRDKNHVQTLISSKNYNDIKMIIKQED GT:EXON 1|1-117:0| BL:SWS:NREP 1 BL:SWS:REP 4->113|ULAC_ECOLI|4e-14|28.2|110/154| PROS 20->36|PS00372|PTS_EIIA_TYPE_2_HIS|PDOC00528| BL:PDB:NREP 1 BL:PDB:REP 1->84|2oq3A|3e-14|39.8|83/147| RP:PDB:NREP 1 RP:PDB:REP 2->116|1a3aA|6e-21|20.5|112/145| RP:PFM:NREP 1 RP:PFM:REP 6->114|PF00359|4e-11|36.8|106/142|PTS_EIIA_2| HM:PFM:NREP 1 HM:PFM:REP 3->115|PF00359|1.8e-29|30.9|110/142|PTS_EIIA_2| GO:PFM:NREP 3 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00359|IPR002178| GO:PFM GO:0006810|"GO:transport"|PF00359|IPR002178| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00359|IPR002178| RP:SCP:NREP 1 RP:SCP:REP 2->116|1a3aA|4e-21|20.5|112/145|d.112.1.1| HM:SCP:REP 2->117|1a6jA_|1.1e-26|28.7|115/150|d.112.1.1|1/1|Phoshotransferase/anion transport protein| OP:NHOMO 400 OP:NHOMOORG 225 OP:PATTERN -------------------------------------------------------------------- ------1------------------------------------------111---1-------1----1---------1-------------------------------------------------------------------------------------------------------------------------111-----143111----21-12--444543---22212212222222-----1---12-----43--13-----2-112212111112222222222222222222222222-22---2223----32222222222-2--1121-1--11----------1---111-1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------1--------------------------------2-111--2223212-21-2212222223212122222333221113333343433233333-22211121-111111111111------------------1111121----1--1---------------------------------------122111111-2122-----------------2-----------------------1--11-------3-1----------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 100.0 SQ:SECSTR HHTTcccTHHHHHHHHHHHHcccEEccETTEEcccccGGGGccccEEEEEEEEEEEEccccTTcEEEEEEEEEcEcTTTHHHHHHHHHHHTccHHHHHHHHHcccHHHHHHHTTTcG DISOP:02AL 1-1,117-118| PSIPRED cccccccHHHHHHHHHHHHHccccEEEccEEEccccccHHHccccEEEEEEEccccccccccccEEEEEEEEEcccHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHccc //