[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54839.1
DDBJ      :             acetyltransferase, GNAT family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  142/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:165 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->161 1tiqB PDBj 1e-23 39.3 %
:RPS:PDB   1->153 3ec4A PDBj 1e-17 13.4 %
:RPS:SCOP  1->161 2b3uA1  d.108.1.1 * 6e-18 20.6 %
:HMM:SCOP  1->165 2b5gA1 d.108.1.1 * 1.8e-30 29.3 %
:RPS:PFM   86->140 PF00583 * Acetyltransf_1 7e-04 38.2 %
:HMM:PFM   60->141 PF00583 * Acetyltransf_1 7.3e-16 29.1 79/83  
:BLT:SWISS 2->164 YPIP_LACDL 4e-30 41.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54839.1 GT:GENE ACF54839.1 GT:PRODUCT acetyltransferase, GNAT family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 510372..510869 GB:FROM 510372 GB:TO 510869 GB:DIRECTION + GB:PRODUCT acetyltransferase, GNAT family GB:NOTE identified by match to protein family HMM PF00583 GB:PROTEIN_ID ACF54839.1 GB:DB_XREF GI:194356391 LENGTH 165 SQ:AASEQ MIRKVEMADVEVLAKIAKQTFAYDNTEEQLQEYFEEAYSLKTLSTELGNPDSETYFIMHEEEIAGFLKVNWGSAQTERELEDAFEIQRLYVLQKFQGFGLGKQLFEFALELATKNSFSWAWLGVWEHNTKAQAFYNRYGFEKFSQHHFMVGQKVDTDWLLRKKLR GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 2->164|YPIP_LACDL|4e-30|41.1|163/173| BL:PDB:NREP 1 BL:PDB:REP 3->161|1tiqB|1e-23|39.3|150/161| RP:PDB:NREP 1 RP:PDB:REP 1->153|3ec4A|1e-17|13.4|134/218| RP:PFM:NREP 1 RP:PFM:REP 86->140|PF00583|7e-04|38.2|55/80|Acetyltransf_1| HM:PFM:NREP 1 HM:PFM:REP 60->141|PF00583|7.3e-16|29.1|79/83|Acetyltransf_1| GO:PFM:NREP 2 GO:PFM GO:0008080|"GO:N-acetyltransferase activity"|PF00583|IPR000182| GO:PFM GO:0008152|"GO:metabolic process"|PF00583|IPR000182| RP:SCP:NREP 1 RP:SCP:REP 1->161|2b3uA1|6e-18|20.6|155/162|d.108.1.1| HM:SCP:REP 1->165|2b5gA1|1.8e-30|29.3|150/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 168 OP:NHOMOORG 156 OP:PATTERN -------------------------------------------------------------------- -1-------------11----------------1111111-----1--------------------------111---1--------------------111-111---------------------------------------------------------------------------------------111112-12-2212211111-1-1----11111--1-1--11111111111111111111211---121-111----1111-----111----11111111111111-------------1111111111---------------------------------11---------------1--1111------------------------------------------1----1--------12---------------------------------------------------------11---------1111----------------1---------------------------------------1-------------------------------------------------------------------------1--------------------------------1------------------------------------------------------------1------------------------------------------1---------------------------------------1------------------------2211111111--------------------------------------------------------------- ----11--------------------------------------------111111----------1--------------------------------1--12-1---1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 100.0 SQ:SECSTR ccccccccccTTcEEccGGGHHccccHHGGcHHHHHHHcccccccTTGGGcccEEEEEETTEEEEEEEccccTccTEETTTTEEEEEEEEEcGGGTTccHHHHHHHHHHHHHHTTcEEEccEEEETTcHHHHHHHHHTTcEEEEEEEEEEEEcccHHHHHHTccc PSIPRED ccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHccccEEEEEEEccEEEEEEEEEccccccccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEEEcc //