[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54840.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.30.5
:114 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   14->113 3dcdA PDBj 3e-09 26.3 %
:RPS:SCOP  2->104 1z45A1  b.30.5.4 * 9e-05 10.2 %
:HMM:SCOP  4->116 1lurA_ b.30.5.4 * 8.2e-05 26.2 %
:BLT:SWISS 1->114 LACXP_LACLA 3e-34 56.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54840.1 GT:GENE ACF54840.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1067453..1067797) GB:FROM 1067453 GB:TO 1067797 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF54840.1 GB:DB_XREF GI:194356392 LENGTH 114 SQ:AASEQ MLDFQDRSPWLEGQKEIDLSYALFSKDAVTLDELQSRTIALRSLKHDRGLKVHFAEFPNLIIWSTLNKGPFITFEPWSGLSTFLEEGDHLEDKKNVCLLEANQVEELGFEIEVL GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 1->114|LACXP_LACLA|3e-34|56.1|114/299| RP:PDB:NREP 1 RP:PDB:REP 14->113|3dcdA|3e-09|26.3|99/292| RP:SCP:NREP 1 RP:SCP:REP 2->104|1z45A1|9e-05|10.2|98/342|b.30.5.4| HM:SCP:REP 4->116|1lurA_|8.2e-05|26.2|103/0|b.30.5.4|1/1|Galactose mutarotase-like| OP:NHOMO 56 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1-1------------------------------------------------------------------------------------111111111111111------111-------111111----------------------------------------------1-112----111-111111-111--------------11---2112---11--------------1-----------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 99.1 SQ:SECSTR EEETTTTEEEEccTccEEcccGGGTTccEEEEcccccEEEEEETTcccEEEEEEETccEEEEEcccccccEEEEEEEEcccccTTccccGGGcTTEEEEcTTcEEEEEEEEEE# PSIPRED ccccccccEEcccccEEEccHHHHHcccEEEEcccEEEEEEcccccccEEEEEcccccEEEEEEccccccEEEEccccccccccccccccHHccccEEEccccEEEEEEEEEEc //