[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54856.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:170 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->158 2if6B PDBj 4e-04 26.7 %
:RPS:SCOP  2->163 2if6A1  d.3.1.21 * 8e-15 21.0 %
:RPS:PFM   2->106 PF05708 * DUF830 1e-12 43.3 %
:HMM:PFM   2->159 PF05708 * DUF830 2.7e-22 30.1 133/155  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54856.1 GT:GENE ACF54856.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1409355..1409867) GB:FROM 1409355 GB:TO 1409867 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF54856.1 GB:DB_XREF GI:194356408 LENGTH 170 SQ:AASEQ MLENGDLIFVRDGSDMGQAIQTSTGNYSHVAIYLDGMIYHASGQAGVVCQEPADFFESNHLYDLYVYPEMDIQSVKERACKHLGAPYNASFYPDAAGFYCSQYIAEILPIFETIPMKFGDGEQEISDFWREYYIELGLPVPLNQAGTNPSQLAASPLLQCKERNLHDSDF GT:EXON 1|1-170:0| BL:PDB:NREP 1 BL:PDB:REP 3->158|2if6B|4e-04|26.7|150/180| RP:PFM:NREP 1 RP:PFM:REP 2->106|PF05708|1e-12|43.3|104/139|DUF830| HM:PFM:NREP 1 HM:PFM:REP 2->159|PF05708|2.7e-22|30.1|133/155|DUF830| RP:SCP:NREP 1 RP:SCP:REP 2->163|2if6A1|8e-15|21.0|162/182|d.3.1.21| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------1--11111111111-------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------1111111------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 88.2 SQ:SECSTR ##cTTcEEEEccccTTHHHHHHHHccccEEEEEEETTEEEEEEEcccEEEEEHHHHHHHcGGGcEEEEEETHHHHHHHHHTTTTccccTTcccccccccHHHHHHHHHH##HHHcccccc#cEEGGGcHHHHH###TTcccTTcEEccHHHHHTcTTE############ DISOP:02AL 1-1,168-171| PSIPRED ccccccEEEEEccccHHHHHHHccccEEEEEEEEEccEEEEEccccEEEHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccHHHHHHcHHHHHHHHHHccccc //