[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54862.1
DDBJ      :             PTS system, IIC component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  262/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:440 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   30->356 PF02378 * PTS_EIIC 7e-08 28.4 %
:HMM:PFM   29->359 PF02378 * PTS_EIIC 9.6e-71 31.7 312/321  
:BLT:SWISS 1->439 YWBA_BACSU 6e-80 36.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54862.1 GT:GENE ACF54862.1 GT:PRODUCT PTS system, IIC component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 418717..420039 GB:FROM 418717 GB:TO 420039 GB:DIRECTION + GB:PRODUCT PTS system, IIC component GB:NOTE identified by match to protein family HMM PF02378; match to protein family HMM TIGR00410 GB:PROTEIN_ID ACF54862.1 GB:DB_XREF GI:194356414 LENGTH 440 SQ:AASEQ MNNILAFLETKVAPFGEKVGNQRHLKAIREGFMMAMPLILVGSLFLILISWPQEAFTNWLNSVGLLSILTTMNQSTVAIISLVACFGIAYRLSEGYGTDGPSAGIIALSSFVLMAPRFSSMVYDKNGEQVKQLFGGAIPFSSLNASSLFMAITIGLVTAEIYRMFIQRGITIKMPSGVPXVVSKSFSALLPGFTTFVLWALVLKGLEAAGVAXGLNGLLGAIVGTPLKLIAGTLPGMILCVIVNSFFWFCGVNGGQVLNAFVDPVWLQFTTENQEAVAAGQTLQHIITLPFKDLFVFIGGGGATIGLAICLFLFSKSRANKTLGKLAIIPSIFNINTAILFTFPTVLNPIMLIPFIATPTINALITYVSMAVGLVPYTTGVILPWTMPPIIGGFLATGASWRGALLQVVLILVSVAIYYPFFKIADKRNLEKEKATVGGK GT:EXON 1|1-440:0| BL:SWS:NREP 1 BL:SWS:REP 1->439|YWBA_BACSU|6e-80|36.5|436/444| TM:NTM 10 TM:REGION 29->51| TM:REGION 64->86| TM:REGION 145->167| TM:REGION 198->220| TM:REGION 227->249| TM:REGION 290->312| TM:REGION 322->344| TM:REGION 350->372| TM:REGION 378->400| TM:REGION 403->425| SEG 200->224|alvlkgleaagvaxglngllgaivg| SEG 298->309|iggggatiglai| RP:PFM:NREP 1 RP:PFM:REP 30->356|PF02378|7e-08|28.4|303/313|PTS_EIIC| HM:PFM:NREP 1 HM:PFM:REP 29->359|PF02378|9.6e-71|31.7|312/321|PTS_EIIC| GO:PFM:NREP 4 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF02378|IPR003352| GO:PFM GO:0008982|"GO:protein-N(PI)-phosphohistidine-sugar phosphotransferase activity"|PF02378|IPR003352| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF02378|IPR003352| GO:PFM GO:0016020|"GO:membrane"|PF02378|IPR003352| OP:NHOMO 686 OP:NHOMOORG 262 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------1--------------2------------------------------------------------------------------------------------------------------------------4444444442446444326433444-1214-49ABAA711-11111111111111111218721581-8157711783-62323341122535422555656755562333333333333445---4444-2-291111111211-8-----1---1-1-1--11--------222---2------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------1-------1--1---------------------------------------1------24--------1------1111-1-1---1-------------4512-611112121222-11122112221211111127884411112111111111111113-1-1-11--4111-1111111-----------------------------111------------------1-1-------------------12242222232-33-----------------1------111-1-------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,429-441| PSIPRED ccHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHcEEEEccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //