[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54866.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54866.1 GT:GENE ACF54866.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 565949..566227 GB:FROM 565949 GB:TO 566227 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF54866.1 GB:DB_XREF GI:194356418 LENGTH 92 SQ:AASEQ MFVIEEVKDENQKKTVVAEVLKDLPEWFGIPESTQAYIEGTTTLQVWXAYQESDLTGFVSLSYSSEDCAEIDCLGVKKLIKVEKLGANCLLL GT:EXON 1|1-92:0| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---------11-------------------1--111-1-1--------------1-----------1------------------1-1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEcHHHHHHHHHHHHHHcHHHccccHHHHHHHHcccccccHHccccccEEEEEEEEcccccccEEEEEEEEEEEEEccccccEEEc //