[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54869.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:47 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->38 PF10955 * DUF2757 0.00023 29.4 34/76  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54869.1 GT:GENE ACF54869.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 186417..186560 GB:FROM 186417 GB:TO 186560 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF54869.1 GB:DB_XREF GI:194356421 LENGTH 47 SQ:AASEQ MLTKEEVNDMIEFKQTHLHRFREIETFVKLCKKSLKQPSQADNPRTF GT:EXON 1|1-47:0| HM:PFM:NREP 1 HM:PFM:REP 2->38|PF10955|0.00023|29.4|34/76|DUF2757| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,34-48| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccccccc //