[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54875.1
DDBJ      :             glycosyl hydrolase family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  161/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
c.1.15c.1.8c.2.1
:738 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   289->467 1zy9A PDBj 3e-14 30.3 %
:RPS:PDB   249->645 1didA PDBj 2e-28 12.8 %
:RPS:SCOP  223->308 1dhrA  c.2.1.2 * 3e-04 5.8 %
:RPS:SCOP  305->642 1bhwA  c.1.15.3 * 4e-25 14.2 %
:HMM:SCOP  325->667 1zy9A2 c.1.8.13 * 3.2e-104 42.0 %
:RPS:PFM   331->557 PF02065 * Melibiase 3e-67 61.3 %
:HMM:PFM   290->687 PF02065 * Melibiase 2.5e-163 53.7 393/394  
:BLT:SWISS 3->709 AGAL1_PEDPE e-161 41.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54875.1 GT:GENE ACF54875.1 GT:PRODUCT glycosyl hydrolase family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1991662..1993878) GB:FROM 1991662 GB:TO 1993878 GB:DIRECTION - GB:PRODUCT glycosyl hydrolase family protein GB:NOTE identified by match to protein family HMM PF02065 GB:PROTEIN_ID ACF54875.1 GB:DB_XREF GI:194356427 LENGTH 738 SQ:AASEQ MTIYINKDETVFHLAMKDSSYIFRILENGELQHLHFGKRIHVKENYNQLMAYEKRGFEVSFSEEFEDIQQSMIQNEYSSYGKGDFRHPAFQVQGMNGSRITTLKYQDFELEKGKNRLNSLPSTFDDIGQCAETLTIILTDSILDLTVRLNYTIFPEYNVLVRNTEFLNNSNNKLTLLKAMSLQLDLPDSQYDFIQFSGAWLRERQLYRTSLRPGIQAIDSLRYSSSPQQNPFFMLSRRETTEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVEFRFLLNPAESFVTPEAIVIYSDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLGTEKILDLAKAAKDLGIELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISIDSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDMNRHITDIYSIELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMYYAPQAWTSDDTDPIERLKIQHGTSYGYSPSMMTAHVSISPNEQSGRQTSLDTRTNVAYFSSFGYELDVTRLSVEEKEQVREQIQFYKKYRSLFQYGDFYRINSPFSCDSASWQVVSKDKCQSILLYAQLNSKLNPGYTRVYFSGLDKDKCYSVSRFDEFFYGDELMNAGIKVSLSNLALCVPEYLTKLFVIEEVVCKY GT:EXON 1|1-738:0| BL:SWS:NREP 1 BL:SWS:REP 3->709|AGAL1_PEDPE|e-161|41.2|704/733| SEG 133->146|tltiiltdsildlt| SEG 167->178|lnnsnnkltllk| BL:PDB:NREP 1 BL:PDB:REP 289->467|1zy9A|3e-14|30.3|165/517| RP:PDB:NREP 1 RP:PDB:REP 249->645|1didA|2e-28|12.8|367/393| RP:PFM:NREP 1 RP:PFM:REP 331->557|PF02065|3e-67|61.3|204/225|Melibiase| HM:PFM:NREP 1 HM:PFM:REP 290->687|PF02065|2.5e-163|53.7|393/394|Melibiase| GO:PFM:NREP 2 GO:PFM GO:0004553|"GO:hydrolase activity, hydrolyzing O-glycosyl compounds"|PF02065|IPR000111| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02065|IPR000111| RP:SCP:NREP 2 RP:SCP:REP 223->308|1dhrA|3e-04|5.8|86/236|c.2.1.2| RP:SCP:REP 305->642|1bhwA|4e-25|14.2|318/392|c.1.15.3| HM:SCP:REP 325->667|1zy9A2|3.2e-104|42.0|326/0|c.1.8.13|1/1|(Trans)glycosidases| OP:NHOMO 245 OP:NHOMOORG 187 OP:PATTERN -------------------------------------------------------------------- 2-2-1----------------------------------1----131-111-111--1-----11--2---2222111----------2221-2-----------1-1-1-----------------------------22---------------------------------------------1111-1------------------1--------11--1--------3---------------------11-22-11-1211124112-11----1------1111122121111-------------222---222-1---2---------------2112--2---3------------11-1--1-------------------------------------------------1--1--------------1-----11-----------------------------------------------11-----------1-----------111---------------1---------------------------------------------------------------------------------------------1-----1-1---------------------------------111-1---------1------1--------------11111------------------------------11111111111-----------------1-----1-------------------1----------------------------111--1--111-12------------------111111--------1---------------------------1111111111--1 ---------------111132222123---------------------1123121-------------------------------------1----------232---------------------------------------------------------------------1---------1---1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 454 STR:RPRED 61.5 SQ:SECSTR ################################################################################################################################################################################################################################cccGGGccEEEEcGGGccEcccccccccTTcccccccccHHHHHHHHHHHTccEEEEEHccHHHccTTccHHHHHHHHHHHHHHHHHHcccccEEEccccccGGGTTccTTcccHHHHHHHHHHHHHHHHHHHHHTccEEEEcccEcTTcEEccTTcccHHHHHHHHHHHHHHHHHHHHHHTcccEEEEEccccccccEEccccHHHHHHHHTTcTTGGGEEEcccHHHHHTTTccHHHHHHHTTTTcHHHHHHTTcccccEEcccccccccTTcccccccTTcccHHHHHHHHHHHHHHHHccTTccccccccEEEcccccTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHTTHHHHTcccccTTccHGGGTTcTTcHHHHHcTTTTTTccHHHHTTccccHHHHHHHHEEETTEEEEEEccTTTcEEEEEEcccTTcccEE############################################################ PSIPRED ccEEEEccccEEEEEcccEEEEEEEcccccEEEEEcccccccccccHHHHHHcccccccccccccccccHHHHHHHccccccccccccEEEEEcccccEEEEEEEcEEEEEccccccccccEEEEEccccccEEEEEEEEccccEEEEEEEEEEccccEEEEEEEEEEcccccEEEEEEEEccccccccccEEEEEccccccccEEEEEEEEccEEEEEccccccccccccEEEEEEccccccccEEEEEEEEEccccEEEEEEccccEEEEEEEEcccccccccccccEEEccEEEEEEccccHHHHHHHHHHHHHHHccccccccccccEEEEccHHEEccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccEEEcccccccHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHHcccccccccccEEEEccccHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHccEEcccccccHHHHHHHHccccccccHHHcccccccccccccccEEEEEEHHHHHHHHHccccccHHHccHHHHHHHHHHHHHHHHccccEEccEEEEccccccccEEEEEEEEccccEEEEEEEEEccccccccccccccccccccEEEEccccEEEcHHHHHHccEEEEccccccccccEEEEEEEEEEEEEcc //